Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282255_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of 293T cells using LC3B Rabbit pAb at dilution of 1:100 (40x lens).293T cells were treated by Chloroquine (50 uM) at 37 degree C for 20 hours. Blue: DAPI for nuclear staining.)

Rabbit LC3B Polyclonal Antibody | anti-LC3B antibody

LC3B Rabbit pAb

Gene Names
Kit; W; Bs; Fdc; Ssm; SCO1; SCO5; SOW3; CD117; c-KIT; Tr-kit; Gsfsco1; Gsfsco5; Gsfsow3
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
LC3B, Antibody; LC3B Rabbit pAb; LC3B; ATG8F; MAP1LC3B-a; MAP1A/1BLC3; MAP1LC3B; LC3A/LC3B; anti-LC3B antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.01% thiomersal, 50% glycerol, pH7.3.
Sequence
SQPSASPGEPSPPSIHPAQSELIVEAGDTLSLTCIDPDFVRWTFKTYFNEMVENKKNEWIQEKAEATRTGTYTCSNSNGLTSSIYVFVRDPAKLFLVGLPLFGKEDSDALVRCPLTDPQVSNYSLIECDGKSLPTDLTFVPNPKAGITIKNVKRAYHRLCVRCAAQRDGTWLHSDKFTLKVRAAIKAIPVVSVPETSHLLKKGDTFTVVCTIKDVSTSVNSMWLKMNPQPQHIAQVKHNSWHRGDFNYERQETLTISSARVDDSGVFMCYANNTFGSANVTTTLKVVEKGFINISPVKNTTVFVTDGENVDLVVEYEAYPKPEHQQWIYMNRTSANKGKDYVKSDNKSNIRYVNQLRLTRLKGTEGGTYTFLVSNSDASASVTFNVYVNTKPEILTYDRLINGMLQCVAEGFPEPTIDWYFCTGAEQRCTTPVSPVDVQVQNVSVSPFGKLVVQSSIDSSVFRHNGTVECKASNDVGKSSAFFNFAFKGNNKEQIQAHT
Applicable Applications for anti-LC3B antibody
IHC (Immunohistochemistry), ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot)
Positive Samples
Rat brain
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-50 of human LC3B (NP_073729.1).
Cellular Location
Cytoplasm, Cytoplasmic vesicle, Endomembrane system, Lipid-anchor, autophagosome, autophagosome membrane, cytoskeleton
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of 293T cells using LC3B Rabbit pAb at dilution of 1:100 (40x lens).293T cells were treated by Chloroquine (50 uM) at 37 degree C for 20 hours. Blue: DAPI for nuclear staining.)

product-image-AAA282255_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of 293T cells using LC3B Rabbit pAb at dilution of 1:100 (40x lens).293T cells were treated by Chloroquine (50 uM) at 37 degree C for 20 hours. Blue: DAPI for nuclear staining.)

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded rat brain using LC3B Rabbit pAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA282255_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded rat brain using LC3B Rabbit pAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded mouse brain using LC3B Rabbit pAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA282255_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded mouse brain using LC3B Rabbit pAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

WB (Western Blot)

(Western blot analysis of extracts of rat brain, using MAP1LC3B antibody.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)

product-image-AAA282255_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of rat brain, using MAP1LC3B antibody.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.)
Related Product Information for anti-LC3B antibody
The product of this gene is a subunit of neuronal microtubule-associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. Studies on the rat homolog implicate a role for this gene in autophagy, a process that involves the bulk degradation of cytoplasmic component.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,814 Da
NCBI Official Full Name
mast/stem cell growth factor receptor Kit isoform 1
NCBI Official Synonym Full Names
KIT proto-oncogene receptor tyrosine kinase
NCBI Official Symbol
Kit
NCBI Official Synonym Symbols
W; Bs; Fdc; Ssm; SCO1; SCO5; SOW3; CD117; c-KIT; Tr-kit; Gsfsco1; Gsfsco5; Gsfsow3
NCBI Protein Information
mast/stem cell growth factor receptor Kit
UniProt Protein Name
Mast/stem cell growth factor receptor Kit
UniProt Gene Name
Kit
UniProt Synonym Gene Names
Sl; SCFR

Similar Products

Product Notes

The LC3B kit (Catalog #AAA282255) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LC3B Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LC3B can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the LC3B kit for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SQPSASPGEP SPPSIHPAQS ELIVEAGDTL SLTCIDPDFV RWTFKTYFNE MVENKKNEWI QEKAEATRTG TYTCSNSNGL TSSIYVFVRD PAKLFLVGLP LFGKEDSDAL VRCPLTDPQV SNYSLIECDG KSLPTDLTFV PNPKAGITIK NVKRAYHRLC VRCAAQRDGT WLHSDKFTLK VRAAIKAIPV VSVPETSHLL KKGDTFTVVC TIKDVSTSVN SMWLKMNPQP QHIAQVKHNS WHRGDFNYER QETLTISSAR VDDSGVFMCY ANNTFGSANV TTTLKVVEKG FINISPVKNT TVFVTDGENV DLVVEYEAYP KPEHQQWIYM NRTSANKGKD YVKSDNKSNI RYVNQLRLTR LKGTEGGTYT FLVSNSDASA SVTFNVYVNT KPEILTYDRL INGMLQCVAE GFPEPTIDWY FCTGAEQRCT TPVSPVDVQV QNVSVSPFGK LVVQSSIDSS VFRHNGTVEC KASNDVGKSS AFFNFAFKGN NKEQIQAHT. It is sometimes possible for the material contained within the vial of "LC3B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.