Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46497_IHC10.jpg IHC (Immunohistochemistry) (Anti- Lck Picoband antibody, AAA46497, IHC(P)IHC(P): Human Tonsil Tissue)

Lck Polyclonal Antibody | anti-LCK antibody

Anti-Lck Antibody

Average rating 0.0
No ratings yet
Gene Names
LCK; LSK; YT16; IMD22; p56lck; pp58lck
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
Lck, Antibody; Anti-Lck Antibody; Tyrosine-protein kinase Lck; IMD22; LCK; Lck p56; LCK proto-oncogene, Src family tyrosine kinase; LCK_HUMAN; Leukocyte C-terminal Src kinase; LSK; Lymphocyte cell specific protein tyrosine kinase; Lymphocyte cell-specific protein-tyrosine kinase; Lymphocyte specific protein tyrosine kinase; Membrane associated protein tyrosine kinase; Oncogene lck; P56 LCK; p56(LSTRA) protein tyrosine kinase; p56-LCK; p56lck; pp58 lck; pp58lck; Protein YT16; Proto oncogene tyrosine protein kinase LCK; Proto-oncogene Lck; Protooncogene tyrosine protein kinase LCK; T cell specific protein tyrosine kinase; T cell-specific protein-tyrosine kinase; T lymphocyte specific protein tyrosine kinase p56lck; YT 16; YT16; anti-LCK antibody
Ordering
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
509
Applicable Applications for anti-LCK antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Lck (468-506aa ELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTATEGQYQ), different from the related mouse and rat sequences by three amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(Anti- Lck Picoband antibody, AAA46497, IHC(P)IHC(P): Human Tonsil Tissue)

product-image-AAA46497_IHC10.jpg IHC (Immunohistochemistry) (Anti- Lck Picoband antibody, AAA46497, IHC(P)IHC(P): Human Tonsil Tissue)

IHC (Immunohistochemisry)

(Anti- Lck Picoband antibody, AAA46497, IHC(P)IHC(P): Rat Lymphaden Tissue)

product-image-AAA46497_IHC11.jpg IHC (Immunohistochemisry) (Anti- Lck Picoband antibody, AAA46497, IHC(P)IHC(P): Rat Lymphaden Tissue)

IHC (Immunohiostchemistry)

(Anti- Lck Picoband antibody, AAA46497, IHC(P)IHC(P): Mouse Lymphaden Tissue)

product-image-AAA46497_IHC13.jpg IHC (Immunohiostchemistry) (Anti- Lck Picoband antibody, AAA46497, IHC(P)IHC(P): Mouse Lymphaden Tissue)

WB (Western Blot)

(Anti- Lck Picoband antibody, AAA46497, Western blottingAll lanes: Anti Lck (AAA46497) at 0.5ug/mlLane 1: HUT Whole Cell Lysate at 40ugLane 2: JURKAT Whole Cell Lysate at 40ugLane 3: RAJI Whole Cell Lysate at 40ugLane 4: CEM Whole Cell Lysate at 40ugLane 5: K562 Whole Cell Lysate at 40ugPredicted bind size: 58KDObserved bind size: 58KD)

product-image-AAA46497_WB15.jpg WB (Western Blot) (Anti- Lck Picoband antibody, AAA46497, Western blottingAll lanes: Anti Lck (AAA46497) at 0.5ug/mlLane 1: HUT Whole Cell Lysate at 40ugLane 2: JURKAT Whole Cell Lysate at 40ugLane 3: RAJI Whole Cell Lysate at 40ugLane 4: CEM Whole Cell Lysate at 40ugLane 5: K562 Whole Cell Lysate at 40ugPredicted bind size: 58KDObserved bind size: 58KD)
Related Product Information for anti-LCK antibody
Description: Rabbit IgG polyclonal antibody for Tyrosine-protein kinase Lck(LCK) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Lck (or lymphocyte-specific protein tyrosine kinase) is a 56 kDa protein that is found inside specializedcells of the immune system called lymphocytes. The human LCK gene is mapped to chromosome 1p35-p32. This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein is a key signaling molecule in the selection and maturation of developing T-cells. It contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to the plasma membrane and pericentrosomal vesicles, and binds to cell surface receptors, including CD4 and CD8, and other signaling molecules. Multiple alternatively spliced variants, encoding the same protein, have been described.
References
1. Anderson, S. J., Levin, S. D., Perlmutter, R. M. Protein tyrosine kinase p56(lck) controls allelic exclusion of T-cell receptor beta-chain genes. Nature 365: 552-554, 1993. 2. Burnett, R. C., David, J.-C., Harden, A. M., Le Beau, M. M., Rowley, J. D., Diaz, M. O. The LCK gene is involved in the t(1;7)(p34;q34) in the T-cell acute lymphoblastic leukemia derived cell line, HSB-2. Genes Chromosomes Cancer 3: 461-467, 1991. 3. Marth, J. D., Disteche, C., Pravtcheva, D., Ruddle, F., Krebs, E. G., Perlmutter, R. M. Localization of a lymphocyte-specific protein tyrosine kinase gene (lck) at a site of frequent chromosomal abnormalities in human lymphomas. Proc. Nat. Acad. Sci. 83: 7400-7404, 1986.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61,190 Da
NCBI Official Full Name
tyrosine-protein kinase Lck
NCBI Official Synonym Full Names
LCK proto-oncogene, Src family tyrosine kinase
NCBI Official Symbol
LCK
NCBI Official Synonym Symbols
LSK; YT16; IMD22; p56lck; pp58lck
NCBI Protein Information
tyrosine-protein kinase Lck
UniProt Protein Name
Tyrosine-protein kinase Lck
UniProt Gene Name
LCK
UniProt Synonym Gene Names
LSK
UniProt Entry Name
LCK_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The LCK lck (Catalog #AAA46497) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-Lck Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Lck can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the LCK lck for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Lck, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.