Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281085_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human kidney using LCP1 Antibody at dilution of 1:100 (40x lens).)

Rabbit anti-Human, Mouse LCP1 Polyclonal Antibody | anti-LCP1 antibody

LCP1 Polyclonal Antibody

Average rating 0.0
No ratings yet
Gene Names
LCP1; LPL; CP64; PLS2; LC64P; HEL-S-37; L-PLASTIN
Reactivity
Human, Mouse
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purification
Synonyms
LCP1, Antibody; LCP1 Polyclonal Antibody; CP64; HEL-S-37; L-PLASTIN; LC64P; LPL; PLS2; anti-LCP1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
ANLFNRYPALHKPENQDIDWGALEGETREERTFRNWMNSLGVNPRVNHLYSDLSDALVIFQLYEKIKVPVDWNRVNKPPYPKLGGNMKKLENCNYAVELGKNQAKFSLVGIGGQDLNEGNRTLTLALIWQLMRRYTLNILEEIGGGQKVNDDIIVNWVNETLREAKKSSSISSFKDPKISTSLPVLDLIDAIQPGSINYDLLKTENLNDDEKLNNAKYAISMARKIGARVYALPEDLVEVNPKMVMTVFACLMGK
Sequence Length
627
Applicable Applications for anti-LCP1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant protein of human LCP1
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cell junction, Cell projection, Cytoplasm, Cytoplasmic side, Peripheral membrane protein, cytoskeleton, ruffle membrane
Positive Samples
SW620, THP-1, H460, Raji, 22Rv1, Mouse liver, Mouse lung, Mouse kidney
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded human kidney using LCP1 Antibody at dilution of 1:100 (40x lens).)

product-image-AAA281085_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human kidney using LCP1 Antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using LCP1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.)

product-image-AAA281085_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using LCP1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.)
Related Product Information for anti-LCP1 antibody
Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. Plastin 1 (otherwise known as Fimbrin) is a third distinct plastin isoform which is specifically expressed at high levels in the small intestine. The L isoform is expressed only in hemopoietic cell lineages, while the T isoform has been found in all other normal cells of solid tissues that have replicative potential (fibroblasts, endothelial cells, epithelial cells, melanocytes, etc.). However, L-plastin has been found in many types of malignant human cells of non-hemopoietic origin suggesting that its expression is induced accompanying tumorigenesis in solid tissues.
Product Categories/Family for anti-LCP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 21kDa; 70kDa
Observed: 73kDa
NCBI Official Full Name
plastin-2
NCBI Official Synonym Full Names
lymphocyte cytosolic protein 1
NCBI Official Symbol
LCP1
NCBI Official Synonym Symbols
LPL; CP64; PLS2; LC64P; HEL-S-37; L-PLASTIN
NCBI Protein Information
plastin-2
UniProt Protein Name
Plastin-2
UniProt Gene Name
LCP1
UniProt Synonym Gene Names
PLS2; LCP-1

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The LCP1 lcp1 (Catalog #AAA281085) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LCP1 Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's LCP1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the LCP1 lcp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ANLFNRYPAL HKPENQDIDW GALEGETREE RTFRNWMNSL GVNPRVNHLY SDLSDALVIF QLYEKIKVPV DWNRVNKPPY PKLGGNMKKL ENCNYAVELG KNQAKFSLVG IGGQDLNEGN RTLTLALIWQ LMRRYTLNIL EEIGGGQKVN DDIIVNWVNE TLREAKKSSS ISSFKDPKIS TSLPVLDLID AIQPGSINYD LLKTENLNDD EKLNNAKYAI SMARKIGARV YALPEDLVEV NPKMVMTVFA CLMGK. It is sometimes possible for the material contained within the vial of "LCP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.