Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283255_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of Mouse ovary tissue using LHCGR Rabbit pAb (AAA283255) at a dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining.)

Rabbit anti-Human LHCGR Polyclonal Antibody | anti-LHCGR antibody

LHCGR Rabbit pAb

Reactivity
Human
Applications
ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
LHCGR, Antibody; LHCGR Rabbit pAb; LHCGR; HHG; LCGR; LGR2; LH/CG-R; LH/CGR; LHR; LHRHR; LSH-R; ULG5; lutropin-choriogonadotropic hormone receptor; anti-LHCGR antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
TSLELKENVHLEKMHNGAFRGATGPKTLDISSTKLQALPSYGLESIQRLIATSSYSLKKLPSRETFVNLLEATLTYPSHCCAFRNLPTKEQNFSHSISENF
Applicable Applications for anti-LHCGR antibody
ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot)
Cross Reactivity
Mouse
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 200-300 of human LHCGR (NP_000224.2).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of Mouse ovary tissue using LHCGR Rabbit pAb (AAA283255) at a dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining.)

product-image-AAA283255_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of Mouse ovary tissue using LHCGR Rabbit pAb (AAA283255) at a dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining. High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining.)

WB (Western Blot)

(Western blot analysis of lysates from Mouse ovary using LHCGR Rabbit pAb (AAA283255) at 1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)

product-image-AAA283255_WB15.jpg WB (Western Blot) (Western blot analysis of lysates from Mouse ovary using LHCGR Rabbit pAb (AAA283255) at 1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)
Related Product Information for anti-LHCGR antibody
This gene encodes the receptor for both luteinizing hormone and choriogonadotropin. This receptor belongs to the G-protein coupled receptor 1 family, and its activity is mediated by G proteins which activate adenylate cyclase. Mutations in this gene result in disorders of male secondary sexual character development, including familial male precocious puberty, also known as testotoxicosis, hypogonadotropic hypogonadism, Leydig cell adenoma with precocious puberty, and male pseudohermaphtoditism with Leydig cell hypoplasia.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 71kDa/78kDa
Observed MW: 94kDa
UniProt Protein Name
Lutropin-choriogonadotropic hormone receptor
UniProt Gene Name
LHCGR
UniProt Synonym Gene Names
LCGR; LGR2; LHRHR; LH/CG-R; LHR; LSH-R
UniProt Entry Name
LSHR_HUMAN

Similar Products

Product Notes

The LHCGR lhcgr (Catalog #AAA283255) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LHCGR Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LHCGR can be used in a range of immunoassay formats including, but not limited to, ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the LHCGR lhcgr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TSLELKENVH LEKMHNGAFR GATGPKTLDI SSTKLQALPS YGLESIQRLI ATSSYSLKKL PSRETFVNLL EATLTYPSHC CAFRNLPTKE QNFSHSISEN F. It is sometimes possible for the material contained within the vial of "LHCGR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.