WB (Western Blot)
(WB Suggested Anti-LRRFIP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: U937 cell lysate)
Rabbit LRRFIP1 Polyclonal Antibody | anti-LRRFIP1 antibody
LRRFIP1 Antibody - middle region
Gene Names
LRRFIP1; GCF2; TRIP; FLAP1; GCF-2; FLAP-1; HUFI-1; FLIIAP1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LRRFIP1, Antibody; LRRFIP1 Antibody - middle region; anti-LRRFIP1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ERQKEFFDSVRSERDDLREEVVMLKEELKKHGIILNSEIATNGETSDTLN
Sequence Length
640
Applicable Applications for anti-LRRFIP1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 86%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human LRRFIP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-LRRFIP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: U937 cell lysate)
WB (Western Blot)
(WB Suggested Anti-LRRFIP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: U937 cell lysate)
WB (Western Blot)
(Host: RabbitTarget Name: LRRFIP1Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/mlLRRFIP1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)
WB (Western Blot)
(Host: RabbitTarget Name: LRRFIP1Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/mlLRRFIP1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)
Related Product Information for anti-LRRFIP1 antibody
This is a rabbit polyclonal antibody against LRRFIP1. It was validated on Western Blot
Target Description: LRRFIP1 is a transcriptional repressor which preferentially binds to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA. LRRFIP1 may control smooth muscle cells proliferation following artery injury through PDGFA repression. LRRFIP1 may also bind double-stranded RNA.
Target Description: LRRFIP1 is a transcriptional repressor which preferentially binds to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA. LRRFIP1 may control smooth muscle cells proliferation following artery injury through PDGFA repression. LRRFIP1 may also bind double-stranded RNA.
Product Categories/Family for anti-LRRFIP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
73kDa
NCBI Official Full Name
leucine-rich repeat flightless-interacting protein 1 isoform 1
NCBI Official Synonym Full Names
LRR binding FLII interacting protein 1
NCBI Official Symbol
LRRFIP1
NCBI Official Synonym Symbols
GCF2; TRIP; FLAP1; GCF-2; FLAP-1; HUFI-1; FLIIAP1
NCBI Protein Information
leucine-rich repeat flightless-interacting protein 1
Similar Products
Product Notes
The LRRFIP1 (Catalog #AAA200891) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LRRFIP1 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's LRRFIP1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the LRRFIP1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ERQKEFFDSV RSERDDLREE VVMLKEELKK HGIILNSEIA TNGETSDTLN. It is sometimes possible for the material contained within the vial of "LRRFIP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.