Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198358_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: MAFSample Type: Lung Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Horse, Human MAF Polyclonal Antibody | anti-MAF antibody

MAF Antibody - C-terminal region

Gene Names
MAF; CCA4; AYGRP; c-MAF; CTRCT21
Reactivity
Horse, Human
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
MAF, Antibody; MAF Antibody - C-terminal region; anti-MAF antibody
Ordering
Host
Rabbit
Reactivity
Horse, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DAYKEKYEKLVSSGFRENGSSSDNPSSPEFFITEPTRKLEPSVGYATFWK
Sequence Length
403
Applicable Applications for anti-MAF antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Horse: 93%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MAF
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: MAFSample Type: Lung Tumor lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA198358_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: MAFSample Type: Lung Tumor lysatesAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-MAF AntibodyParaffin Embedded Tissue: Human Lung cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA198358_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-MAF AntibodyParaffin Embedded Tissue: Human Lung cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-MAF antibody
This is a rabbit polyclonal antibody against MAF. It was validated on Western Blot

Target Description: The protein encoded by this gene is a DNA-binding, leucine zipper-containing transcription factor that acts as a homodimer or as a heterodimer. Depending on the binding site and binding partner, the encoded protein can be a transcriptional activator or repressor. This protein plays a role in the regulation of several cellular processes, including embryonic lens fiber cell development, increased T-cell susceptibility to apoptosis, and chondrocyte terminal differentiation. Defects in this gene are a cause of juvenile-onset pulverulent cataract as well as congenital cerulean cataract 4 (CCA4). Two transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
transcription factor Maf isoform b
NCBI Official Synonym Full Names
MAF bZIP transcription factor
NCBI Official Symbol
MAF
NCBI Official Synonym Symbols
CCA4; AYGRP; c-MAF; CTRCT21
NCBI Protein Information
transcription factor Maf
UniProt Protein Name
Transcription factor Maf
UniProt Gene Name
MAF
UniProt Entry Name
MAF_HUMAN

Similar Products

Product Notes

The MAF maf (Catalog #AAA198358) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAF Antibody - C-terminal region reacts with Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAF can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the MAF maf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DAYKEKYEKL VSSGFRENGS SSDNPSSPEF FITEPTRKLE PSVGYATFWK. It is sometimes possible for the material contained within the vial of "MAF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.