Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281763_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of C6 cells using MAML2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit MAML2 Polyclonal Antibody | anti-MAML2 antibody

MAML2 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
MAML2; MAM2; MAM3; MAM-3; KIAA1819; MGC176701; MLL-MAML2; DKFZp686N0150
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
MAML2, Antibody; MAML2 Rabbit pAb; MAML2; MAM-3; MAM2; MAM3; MLL-MAML2; anti-MAML2 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
NQQLMGKKQTLQRQIMEQKQQLLLQQQMLADAEKIAPQDQINRHLSRPPPDYKDQRRNVGNMQPTAQYSGGSSTISLNSNQALANPVSTHTILTPNSSLLS
Applicable Applications for anti-MAML2 antibody
IF (Immunofluorescence), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 750-850 of human MAML2 (NP_115803.1).
Positive Samples
A-549, 293T, Mouse brain, Mouse lung
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of C6 cells using MAML2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281763_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of C6 cells using MAML2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using MAML2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

product-image-AAA281763_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using MAML2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Related Product Information for anti-MAML2 antibody
Background: The protein encoded by this gene is a member of the Mastermind-like family of proteins. All family members are proline and glutamine-rich, and contain a conserved basic domain that binds the ankyrin repeat domain of the intracellular domain of the Notch receptors (ICN1-4) in their N-terminus, and a transcriptional activation domain in their C-terminus. This protein binds to an extended groove that is formed by the interaction of CBF1, Suppressor of Hairless, LAG-1 (CSL) with ICN, and positively regulates Notch signaling. High levels of expression of this gene have been observed in several B cell-derived lymphomas. Translocations resulting in fusion proteins with both CRTC1 and CRTC3 have been implicated in the development of mucoepidermoid carcinomas, while a translocation event with CXCR4 has been linked with chronic lymphocytic leukemia (CLL). Copy number variation in the polyglutamine tract has been observed.
Product Categories/Family for anti-MAML2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
125,197 Da
NCBI Official Full Name
mastermind-like protein 2
NCBI Official Synonym Full Names
mastermind-like 2 (Drosophila)
NCBI Official Symbol
MAML2
NCBI Official Synonym Symbols
MAM2; MAM3; MAM-3; KIAA1819; MGC176701; MLL-MAML2; DKFZp686N0150
NCBI Protein Information
mastermind-like protein 2; mam-2; OTTHUMP00000236424; OTTHUMP00000236425
UniProt Protein Name
Mastermind-like protein 2
UniProt Gene Name
MAML2
UniProt Synonym Gene Names
KIAA1819
UniProt Entry Name
MAML2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The MAML2 maml2 (Catalog #AAA281763) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAML2 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MAML2 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the MAML2 maml2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NQQLMGKKQT LQRQIMEQKQ QLLLQQQMLA DAEKIAPQDQ INRHLSRPPP DYKDQRRNVG NMQPTAQYSG GSSTISLNSN QALANPVSTH TILTPNSSLL S. It is sometimes possible for the material contained within the vial of "MAML2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.