Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201479_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: MAP2Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human MAP2 Polyclonal Antibody | anti-MAP2 antibody

MAP2 Antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
MAP2; MAP-2; MAP2A; MAP2B; MAP2C
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
MAP2, Antibody; MAP2 Antibody - N-terminal region; anti-MAP2 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TPSTAEPSDQKEKESEKQSKPGEDLKHAALVSQPETTKTYPDKKDMQGTE
Sequence Length
1827
Applicable Applications for anti-MAP2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human MAP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: MAP2Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA201479_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: MAP2Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-MAP2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Thyroid Gland TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA201479_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-MAP2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Thyroid Gland TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-MAP2 antibody
This is a rabbit polyclonal antibody against MAP2. It was validated on Western Blot

Target Description: This gene encodes a protein that belongs to the microtubule-associated protein family. The proteins of this family are thought to be involved in microtubule assembly, which is an essential step in neurogenesis. The products of similar genes in rat and mouse are neuron-specific cytoskeletal proteins that are enriched in dentrites, implicating a role in determining and stabilizing dentritic shape during neuron development. A number of alternatively spliced variants encoding distinct isoforms have been described.
Product Categories/Family for anti-MAP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
200kDa
NCBI Official Full Name
microtubule-associated protein 2 isoform 1
NCBI Official Synonym Full Names
microtubule associated protein 2
NCBI Official Symbol
MAP2
NCBI Official Synonym Symbols
MAP-2; MAP2A; MAP2B; MAP2C
NCBI Protein Information
microtubule-associated protein 2
UniProt Protein Name
Microtubule-associated protein 2
UniProt Gene Name
MAP2
UniProt Synonym Gene Names
MAP-2
UniProt Entry Name
MTAP2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The MAP2 map2 (Catalog #AAA201479) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAP2 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAP2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the MAP2 map2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TPSTAEPSDQ KEKESEKQSK PGEDLKHAAL VSQPETTKTY PDKKDMQGTE. It is sometimes possible for the material contained within the vial of "MAP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.