Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199041_WB13.jpg WB (Western Blot) (WB Suggested Anti-MAP2K3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateMAP2K3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Rabbit MAP2K3 Polyclonal Antibody | anti-MAP2K3 antibody

MAP2K3 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
MAP2K3; MEK3; MKK3; MAPKK3; PRKMK3; SAPKK2; SAPKK-2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
MAP2K3, Antibody; MAP2K3 antibody - C-terminal region; anti-MAP2K3 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKK
Sequence Length
318
Applicable Applications for anti-MAP2K3 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human MAP2K3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-MAP2K3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateMAP2K3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

product-image-AAA199041_WB13.jpg WB (Western Blot) (WB Suggested Anti-MAP2K3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateMAP2K3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

IHC (Immunohistochemistry)

(MAP2K3 antibody - C-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA199041_IHC15.jpg IHC (Immunohistochemistry) (MAP2K3 antibody - C-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-MAP2K3 antibody
This is a rabbit polyclonal antibody against MAP2K3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: MAP2K3 is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is activated by mitogenic and environmental stress, and participates in the MAP kinase-mediated signaling cascade. It phosphorylates and thus activates MAPK14/p38-MAPK. This kinase can be activated by insulin, and is necessary for the expression of glucose transporter. Expression of RAS oncogene is found to result in the accumulation of the active form of this kinase, which thus leads to the constitutive activation of MAPK14, and confers oncogenic transformation of primary cells. The inhibition of this kinase is involved in the pathogenesis of Yersina pseudotuberculosis. The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is activated by mitogenic and environmental stress, and participates in the MAP kinase-mediated signaling cascade. It phosphorylates and thus activates MAPK14/p38-MAPK. This kinase can be activated by insulin, and is necessary for the expression of glucose transporter. Expression of RAS oncogene is found to result in the accumulation of the active form of this kinase, which thus leads to the constitutive activation of MAPK14, and confers oncogenic transformation of primary cells. The inhibition of this kinase is involved in the pathogenesis of Yersina pseudotuberculosis. Multiple alternatively spliced transcript variants that encode distinct isoforms have been reported for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
dual specificity mitogen-activated protein kinase kinase 3 isoform A
NCBI Official Synonym Full Names
mitogen-activated protein kinase kinase 3
NCBI Official Symbol
MAP2K3
NCBI Official Synonym Symbols
MEK3; MKK3; MAPKK3; PRKMK3; SAPKK2; SAPKK-2
NCBI Protein Information
dual specificity mitogen-activated protein kinase kinase 3
UniProt Protein Name
Dual specificity mitogen-activated protein kinase kinase 3
UniProt Gene Name
MAP2K3
UniProt Synonym Gene Names
MEK3; MKK3; PRKMK3; SKK2; MAP kinase kinase 3; MAPKK 3; MEK 3; SAPK kinase 2; SAPKK-2; SAPKK2
UniProt Entry Name
MP2K3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The MAP2K3 map2k3 (Catalog #AAA199041) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAP2K3 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's MAP2K3 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the MAP2K3 map2k3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EEPSPQLPAD RFSPEFVDFT AQCLRKNPAE RMSYLELMEH PFFTLHKTKK. It is sometimes possible for the material contained within the vial of "MAP2K3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.