Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197356_WB11.jpg WB (Western Blot) (WB Suggested Anti-MAP3K7IP2 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateTAB2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

Rabbit MAP3K7IP2 Polyclonal Antibody | anti-TAB2 antibody

MAP3K7IP2 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
TAB2; CHTD2; TAB-2; MAP3K7IP2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
MAP3K7IP2, Antibody; MAP3K7IP2 antibody - N-terminal region; anti-TAB2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDLNFSDDSG
Sequence Length
693
Applicable Applications for anti-TAB2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human MAP3K7IP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-MAP3K7IP2 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateTAB2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

product-image-AAA197356_WB11.jpg WB (Western Blot) (WB Suggested Anti-MAP3K7IP2 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateTAB2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

IHC (Immunohiostchemistry)

(Human Stomach)

product-image-AAA197356_IHC13.jpg IHC (Immunohiostchemistry) (Human Stomach)

IHC (Immunohistochemistry)

(Human Spermatophore)

product-image-AAA197356_IHC15.jpg IHC (Immunohistochemistry) (Human Spermatophore)
Related Product Information for anti-TAB2 antibody
This is a rabbit polyclonal antibody against MAP3K7IP2. It was validated on Western Blot and immunohistochemistry

Target Description: MAP3K7IP2 is an activator of MAP3K7/TAK1, which is required for for the IL-1 induced activation of NF.:B and MAPK8/JNK. This protein forms a kinase complex with TRAF6, MAP3K7 and TAB1, thus serving as an adaptor linking MAP3K7 and TRAF6. This protein, TAB1, and MAP3K7 also participate in the signal transduction induced by TNFSF11/RANKl through the activation of the receptor activator of NF.:B (TNFRSF11A/RANK), which may regulate the development and function of osteoclasts.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
76kDa
NCBI Official Full Name
TGF-beta-activated kinase 1 and MAP3K7-binding protein 2 isoform a
NCBI Official Synonym Full Names
TGF-beta activated kinase 1 (MAP3K7) binding protein 2
NCBI Official Symbol
TAB2
NCBI Official Synonym Symbols
CHTD2; TAB-2; MAP3K7IP2
NCBI Protein Information
TGF-beta-activated kinase 1 and MAP3K7-binding protein 2
UniProt Protein Name
TGF-beta-activated kinase 1 and MAP3K7-binding protein 2
UniProt Gene Name
TAB2
UniProt Synonym Gene Names
KIAA0733; MAP3K7IP2; TAB-2
UniProt Entry Name
TAB2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The TAB2 tab2 (Catalog #AAA197356) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAP3K7IP2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MAP3K7IP2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the TAB2 tab2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QKFPEVPEVV VSRCMLQNNN NLDACCAVLS QESTRYLYGE GDLNFSDDSG. It is sometimes possible for the material contained within the vial of "MAP3K7IP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.