WB (Western Blot)
(Host: RabbitTarget Name: MAPK8Sample Tissue: Human DLD1 Whole CellAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human MAPK8 Polyclonal Antibody | anti-MAPK8 antibody
MAPK8 Antibody - N-terminal region
Gene Names
MAPK8; JNK; JNK1; PRKM8; SAPK1; JNK-46; JNK1A2; SAPK1c; JNK21B1/2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MAPK8, Antibody; MAPK8 Antibody - N-terminal region; anti-MAPK8 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILER
Sequence Length
427
Applicable Applications for anti-MAPK8 antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human MAPK8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(Host: RabbitTarget Name: MAPK8Sample Tissue: Human DLD1 Whole CellAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: MAPK8Sample Tissue: Human DLD1 Whole CellAntibody Dilution: 1.0ug/ml)
IHC (Immunohistochemistry)
(Rabbit Anti-MAPK8 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Thyroid Gland TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
IHC (Immunohistochemistry)
(Rabbit Anti-MAPK8 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Thyroid Gland TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-MAPK8 antibody
The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various cell stimuli, and targets specific transcription factors, and thus mediates immediate-early gene expression in response to cell stimuli. The activation of this kinase by tumor-necrosis factor alpha (TNF-alpha) is found to be required for TNF-alpha induced apoptosis. This kinase is also involved in UV radiation induced apoptosis, which is thought to be related to cytochrom c-mediated cell death pathway. Studies of the mouse counterpart of this gene suggested that this kinase play a key role in T cell proliferation, apoptosis and differentiation. Five alternatively spliced transcript variants encoding distinct isoforms have been reported.
Product Categories/Family for anti-MAPK8 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48 kDa
NCBI Official Full Name
mitogen-activated protein kinase 8 isoform beta2
NCBI Official Synonym Full Names
mitogen-activated protein kinase 8
NCBI Official Symbol
MAPK8
NCBI Official Synonym Symbols
JNK; JNK1; PRKM8; SAPK1; JNK-46; JNK1A2; SAPK1c; JNK21B1/2
NCBI Protein Information
mitogen-activated protein kinase 8
UniProt Protein Name
Mitogen-activated protein kinase 8
UniProt Gene Name
MAPK8
UniProt Synonym Gene Names
JNK1; PRKM8; SAPK1; SAPK1C; MAP kinase 8; MAPK 8; SAPK1c
UniProt Entry Name
MK08_HUMAN
Similar Products
Product Notes
The MAPK8 mapk8 (Catalog #AAA201559) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAPK8 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAPK8 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the MAPK8 mapk8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSRSKRDNNF YSVEIGDSTF TVLKRYQNLK PIGSGAQGIV CAAYDAILER. It is sometimes possible for the material contained within the vial of "MAPK8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.