WB (Western Blot)
(Host: RabbitTarget Name: MARHBSample Type: Fetal Kidney lysatesAntibody Dilution: 1ug/ml)
Rabbit MARCH11 Polyclonal Antibody | anti-MARCH11 antibody
MARCH11 Antibody - C-terminal region
Gene Names
MARCH11; RNF226; MARCH-XI
Reactivity
Human; Predicted: Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MARCH11, Antibody; MARCH11 Antibody - C-terminal region; anti-MARCH11 antibody
Host
Rabbit
Reactivity
Human; Predicted: Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: RVFKRWRAVNLHWDVLNYDKATDIEESSRGESSTSRTLWLPLTALRNRNL
Sequence Length
402
Applicable Applications for anti-MARCH11 antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MARHB
Protein Size (#AA)
402 amino acids
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(Host: RabbitTarget Name: MARHBSample Type: Fetal Kidney lysatesAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: MARHBSample Type: Fetal Kidney lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-MARCH11 antibody
Target Description: MARCH11 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). These enzymes add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their intracellular transport. March11 appears to have a role in ubiquitin-mediated protein sorting in the trans-Golgi network (TGN)-multivesicular body (MVB) transport pathway (Morokuma et al., 2007 [PubMed 17604280]).[supplied by OMIM, Apr 2010]
Product Categories/Family for anti-MARCH11 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase MARCH11
NCBI Official Synonym Full Names
membrane associated ring-CH-type finger 11
NCBI Official Symbol
MARCH11
NCBI Official Synonym Symbols
RNF226; MARCH-XI
NCBI Protein Information
E3 ubiquitin-protein ligase MARCH11
UniProt Protein Name
E3 ubiquitin-protein ligase MARCH11
UniProt Gene Name
MARCH11
UniProt Synonym Gene Names
MARCH-XI
UniProt Entry Name
MARHB_HUMAN
Similar Products
Product Notes
The MARCH11 march11 (Catalog #AAA199269) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MARCH11 Antibody - C-terminal region reacts with Human; Predicted: Human and may cross-react with other species as described in the data sheet. AAA Biotech's MARCH11 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the MARCH11 march11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RVFKRWRAVN LHWDVLNYDK ATDIEESSRG ESSTSRTLWL PLTALRNRNL. It is sometimes possible for the material contained within the vial of "MARCH11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.