Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA125649_FCM11.png FCM/FACS (Flow Cytometry) (Figure 3. Flow Cytometry analysis of U20S cells using anti-MBD1 antibody (AAA125649).Overlay histogram showing U20S cells stained with AAA125649 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-MBD1 Antibody (AAA125649, 1μg/1x106 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

Rabbit MBD1 Polyclonal Antibody | anti-MBD1 antibody

Anti-MBD1 Antibody

Gene Names
MBD1; RFT; PCM1; CXXC3
Reactivity
Human, Mouse, Rat
Applications
Flow Cytometry, Functional Assay, Western Blot
Purity
Immunogen affinity purified.
Synonyms
MBD1, Antibody; Anti-MBD1 Antibody; MBD1; CXXC3; PCM1; Methyl-CpG-binding domain protein 1; CXXC-type zinc finger protein 3; Methyl-CpG-binding protein MBD1; Protein containing methyl-CpG-binding domain 1; methyl-CpG binding domain protein 1; anti-MBD1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
Rabbit IgG
Specificity
Rabbit IgG polyclonal antibody for MBD1 detection.
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized. Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.01mg NaN3.
Applicable Applications for anti-MBD1 antibody
FCM/FACS (Flow Cytometry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence of human MBD1 (DLTLFDFKQGILCYPAPKAHPVAVASKKRK).
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Recommended Detection Systems
Recommended Detection Systems
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

FCM/FACS (Flow Cytometry)

(Figure 3. Flow Cytometry analysis of U20S cells using anti-MBD1 antibody (AAA125649).Overlay histogram showing U20S cells stained with AAA125649 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-MBD1 Antibody (AAA125649, 1μg/1x106 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA125649_FCM11.png FCM/FACS (Flow Cytometry) (Figure 3. Flow Cytometry analysis of U20S cells using anti-MBD1 antibody (AAA125649).Overlay histogram showing U20S cells stained with AAA125649 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-MBD1 Antibody (AAA125649, 1μg/1x106 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

FCM/FACS (Flow Cytometry)

(Figure 2. Flow Cytometry analysis of A549 cells using anti-MBD1 antibody (AAA125649).Overlay histogram showing A549 cells stained with AAA125649 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-MBD1 Antibody (AAA125649, 1μg/1x106 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA125649_FCM13.png FCM/FACS (Flow Cytometry) (Figure 2. Flow Cytometry analysis of A549 cells using anti-MBD1 antibody (AAA125649).Overlay histogram showing A549 cells stained with AAA125649 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-MBD1 Antibody (AAA125649, 1μg/1x106 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

WB (Western Blot)

(Figure 1. Western blot analysis of MBD1 using anti-MBD1 antibody (AAA125649).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: human Jurkat whole cell lysatesLane 2: human HELA whole cell lysatesLane 3: human HEK293 whole cell lysatesLane 4: human HEPG2 whole cell lysatesLane 5: human U20S whole cell lysatesLane 6: rat thymus tissue lysates,Lane 7: mouse thymus tissue lysates,Lane 8: mouse SP2/0 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1. 5 hour at RT. The membrane was incubated with rabbit anti-MBD1 antigen affinity purified polyclonal antibody (Catalog # AAA125649) at 0. 5 μg/mL overnight at 4 degree C, then washed with TBS-0. 1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1. 5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for MBD1 at approximately 67KD. The expected band size for MBD1 is at 67KD.)

product-image-AAA125649_WB15.jpg WB (Western Blot) (Figure 1. Western blot analysis of MBD1 using anti-MBD1 antibody (AAA125649).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: human Jurkat whole cell lysatesLane 2: human HELA whole cell lysatesLane 3: human HEK293 whole cell lysatesLane 4: human HEPG2 whole cell lysatesLane 5: human U20S whole cell lysatesLane 6: rat thymus tissue lysates,Lane 7: mouse thymus tissue lysates,Lane 8: mouse SP2/0 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1. 5 hour at RT. The membrane was incubated with rabbit anti-MBD1 antigen affinity purified polyclonal antibody (Catalog # AAA125649) at 0. 5 μg/mL overnight at 4 degree C, then washed with TBS-0. 1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1. 5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for MBD1 at approximately 67KD. The expected band size for MBD1 is at 67KD.)
Related Product Information for anti-MBD1 antibody
MBD1(Methyl-CpG-Binding Domain Protein 1), also known as PCM1 or CXXC3, is a protein that in humans is encoded by the MBD1 gene. Using PCR on a hybrid panel and FISH, Hendrich et al. (1999) mapped the MBD1 gene to chromosome 18q21, 2. 1 cM distal to MBD2. Using yeast 2-hybrid analysis, reciprocal immunoprecipitation analysis, and protein pull-down assays, Fujita et al. (2003) showed that MBD1 interacted directly with MCAF. Deletion analysis revealed that the C-terminal transcriptional repressor domain(TRD) of MBD1 interacted with a conserved C-terminal domain of MCAF. Reporter gene assays showed that MCAF increased the repressive function of the isolated TRD of MBD1 against SP1. Chromatin immunoprecipitation analysis revealed that MBD1 linked MCAF to methylated promoters. Uchimura et al. (2006) found that MBD1 was multiply sumoylated in HeLa cells. Sumoylation did not alter the intracellular localization of MBD1 at nuclear foci in C-33A human cervical cancer cells.
References
1. Fujita, N., Watanabe, S., Ichimura, T., Ohkuma, Y., Chiba, T., Saya, H., Nakao, M. MCAF mediates MBD1-dependent transcriptional repression. Molec. Cell. Biol. 23: 2834-2843, 2003.
2. Hendrich, B., Abbott, C., McQueen, H., Chambers, D., Cross, S., Bird, A. Genomic structure and chromosomal mapping of the murine and human Mbd1, Mbd2, Mbd3, and Mbd4 genes. Mammalian Genome 10: 906-912, 1999.
3. Uchimura, Y., Ichimura, T., Uwada, J., Tachibana, T., Sugahara, S., Nakao, M., Saitoh, H. Involvement of SUMO modification in MBD1- and MCAF1-mediated heterochromatin formation. J. Biol. Chem. 281: 23180-23190, 2006.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
605
NCBI Official Full Name
methyl-CpG-binding domain protein 1 isoform 6
NCBI Official Synonym Full Names
methyl-CpG binding domain protein 1
NCBI Official Symbol
MBD1
NCBI Official Synonym Symbols
RFT; PCM1; CXXC3
NCBI Protein Information
methyl-CpG-binding domain protein 1; CXXC-type zinc finger protein 3; protein containing methyl-CpG-binding domain 1; methyl-CpG binding domain protein 1 isoform PCM1; the regulator of fibroblast growth factor 2 (FGF-2) transcription
UniProt Protein Name
Methyl-CpG-binding domain protein 1
UniProt Gene Name
MBD1
UniProt Synonym Gene Names
CXXC3; PCM1
UniProt Entry Name
MBD1_HUMAN

Similar Products

Product Notes

The MBD1 mbd1 (Catalog #AAA125649) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-MBD1 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MBD1 can be used in a range of immunoassay formats including, but not limited to, FCM/FACS (Flow Cytometry), WB (Western Blot). Researchers should empirically determine the suitability of the MBD1 mbd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MBD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.