Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197885_WB13.jpg WB (Western Blot) (WB Suggested Anti-MBD4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Hela cell lysateMBD4 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

Rabbit MBD4 Polyclonal Antibody | anti-MBD4 antibody

MBD4 antibody - middle region

Gene Names
MBD4; MED1
Reactivity
Guinea Pig, Human
Applications
Western Blot, Chromatin Immunoprecipitation, Immunoprecipitation
Purity
Affinity Purified
Synonyms
MBD4, Antibody; MBD4 antibody - middle region; anti-MBD4 antibody
Ordering
Host
Rabbit
Reactivity
Guinea Pig, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CSEQKTSGIINKFCSAKDSEHNEKYEDTFLESEEIGTKVEVVERKEHLHT
Sequence Length
580
Applicable Applications for anti-MBD4 antibody
WB (Western Blot), ChIP (Chromatin immunoprecipitation)
Homology
Guinea Pig: 83%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MBD4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-MBD4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Hela cell lysateMBD4 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

product-image-AAA197885_WB13.jpg WB (Western Blot) (WB Suggested Anti-MBD4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Hela cell lysateMBD4 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

ChIP (Chromatin Immunoprecipitation)

(Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.)

product-image-AAA197885_CHIP15.jpg ChIP (Chromatin Immunoprecipitation) (Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.)
Related Product Information for anti-MBD4 antibody
This is a rabbit polyclonal antibody against MBD4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: MBD4 is involved with DNA methylation. DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD3 comprise a family of nuclear proteins related by??he presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MBD4 may function to mediate the biological consequences of the methylation signal. In addition, MBD4 has protein sequence similarity to bacterial DNA repair enzymes and thus may have some function in DNA repair. Further, MBD4 gene mutations are detected in tumors with primary microsatellite-instability (MSI), a form of genomic instability associated with defective DNA mismatch repair, and MBD4 gene meets 4 of 5 criteria of a bona fide MIS target gene.DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MBD4 may function to mediate the biological consequences of the methylation signal. In addition, MBD4 has protein sequence similarity to bacterial DNA repair enzymes and thus may have some function in DNA repair. Further, MBD4 gene mutations are detected in tumors with primary microsatellite-instability (MSI), a form of genomic instability associated with defective DNA mismatch repair, and MBD4 gene meets 4 of 5 criteria of a bona fide MIS target gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66kDa
NCBI Official Full Name
methyl-CpG-binding domain protein 4 isoform 1
NCBI Official Synonym Full Names
methyl-CpG binding domain 4, DNA glycosylase
NCBI Official Symbol
MBD4
NCBI Official Synonym Symbols
MED1
NCBI Protein Information
methyl-CpG-binding domain protein 4
UniProt Protein Name
Methyl-CpG-binding domain protein 4
UniProt Gene Name
MBD4
UniProt Synonym Gene Names
MED1
UniProt Entry Name
MBD4_HUMAN

Similar Products

Product Notes

The MBD4 mbd4 (Catalog #AAA197885) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MBD4 antibody - middle region reacts with Guinea Pig, Human and may cross-react with other species as described in the data sheet. AAA Biotech's MBD4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), ChIP (Chromatin immunoprecipitation). Researchers should empirically determine the suitability of the MBD4 mbd4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CSEQKTSGII NKFCSAKDSE HNEKYEDTFL ESEEIGTKVE VVERKEHLHT. It is sometimes possible for the material contained within the vial of "MBD4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.