Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46339_IHC13.jpg IHC (Immunohiostchemistry) (MDMX was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- MDMX Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

anti-Human, Mouse MDMX Polyclonal Antibody | anti-MDMX antibody

Anti-MDMX Antibody

Gene Names
MDM4; HDMX; MDMX; MRP1
Reactivity
Human, Mouse
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
MDMX, Antibody; Anti-MDMX Antibody; Protein Mdm4; DKFZp781B1423; Double minute 4; Double minute 4 human homolog of p53 binding protein; Double minute 4 protein; HDMX; MDM 4; Mdm2 like p53 binding protein; Mdm2-like p53-binding protein; MDM4; Mdm4 p53 binding protein homolog mouse; Mdm4 protein; MDM4 related protein 1; Mdm4 transformed 3T3 cell double minute 4; Mdm4 transformed 3T3 cell double minute 4 p53 binding protein; Mdm4 transformed 3T3 cell double minute 4 p53 binding protein mouse; MDM4_HUMAN; Mdmx protein; MGC132766; Mouse double minute 4 homolog; Mouse double minute 4 human homolog of p53 binding protein; MRP 1; MRP1; p53 binding protein; p53 BINDING PROTEIN MDM4; p53-binding protein Mdm4; Protein Mdmx; MDM4, p53 regulator; anti-MDMX antibody
Ordering
Reactivity
Human, Mouse
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
440
Applicable Applications for anti-MDMX antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human MDMX (35-72aa KILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQH), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohiostchemistry)

(MDMX was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- MDMX Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46339_IHC13.jpg IHC (Immunohiostchemistry) (MDMX was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- MDMX Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

WB (Western Blot)

(Western blot analysis of MDMX expression in mouse testis extract (lane 1) and 22RV1 whole cell lysates (lane 2). MDMX at75KD was detected using rabbit anti- MDMX Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.)

product-image-AAA46339_WB15.jpg WB (Western Blot) (Western blot analysis of MDMX expression in mouse testis extract (lane 1) and 22RV1 whole cell lysates (lane 2). MDMX at75KD was detected using rabbit anti- MDMX Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.)
Related Product Information for anti-MDMX antibody
Description: Rabbit IgG polyclonal antibody for Protein Mdm4(MDM4) detection. Tested with WB, IHC-P in Human;Mouse.

Background: Protein Mdm4 is a protein that in humans is encoded by the MDM4 gene. This gene encodes a nuclear protein that contains a p53 binding domain at the N-terminus and a RING finger domain at the C-terminus, and shows structural similarity to p53-binding protein MDM2. Both proteins bind the p53 tumor suppressor protein and inhibit its activity, and have been shown to be overexpressed in a variety of human cancers. However, unlike MDM2 which degrades p53, this protein inhibits p53 by binding its transcriptional activation domain. This protein also interacts with MDM2 protein via the RING finger domain, and inhibits the latter's degradation. So this protein can reverse MDM2-targeted degradation of p53, while maintaining suppression of p53 transactivation and apoptotic functions. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. 
References
1. "Entrez Gene: MDM4 Mdm4, transformed 3T3 cell double minute 4, p53 binding protein (mouse)". 2. Kadakia M, Brown TL, McGorry MM, Berberich SJ (Dec 2002). "MdmX inhibits Smad transactivation". Oncogene21 (57): 8776-85. 3. Shvarts A, Bazuine M, Dekker P, Ramos YF, Steegenga WT, Merckx G, van Ham RC, van der Houven van Oordt W, van der Eb AJ, Jochemsen AG (Sep 1997). "Isolation and identification of the human homolog of a new p53-binding protein, Mdmx". Genomics 43 (1): 34-42. 

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49,541 Da
NCBI Official Full Name
protein Mdm4 isoform 2
NCBI Official Synonym Full Names
MDM4, p53 regulator
NCBI Official Symbol
MDM4
NCBI Official Synonym Symbols
HDMX; MDMX; MRP1
NCBI Protein Information
protein Mdm4
UniProt Protein Name
Protein Mdm4
UniProt Gene Name
MDM4
UniProt Synonym Gene Names
MDMX
UniProt Entry Name
MDM4_HUMAN

Similar Products

Product Notes

The MDMX mdm4 (Catalog #AAA46339) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-MDMX Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's MDMX can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the MDMX mdm4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MDMX, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.