Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201534_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: MED15Sample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human MED15 Polyclonal Antibody | anti-MED15 antibody

MED15 Antibody - C-terminal region

Gene Names
MED15; TIG1; CAG7A; CTG7A; PCQAP; TIG-1; TNRC7; ARC105
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MED15, Antibody; MED15 Antibody - C-terminal region; anti-MED15 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TPQSMPPPPQPSPQPGQPSSQPNSNVSSGPAPSPSSFLPSPSPQPSQSPV
Sequence Length
788
Applicable Applications for anti-MED15 antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MED15
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: MED15Sample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA201534_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: MED15Sample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: MED15Sample Tissue: Human ACHN Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA201534_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: MED15Sample Tissue: Human ACHN Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-MED15 antibody
This is a rabbit polyclonal antibody against MED15. It was validated on Western Blot

Target Description: The protein encoded by this gene is a subunit of the multiprotein complexes PC2 and ARC/DRIP and may function as a transcriptional coactivator in RNA polymerase II transcription. This gene contains stretches of trinucleotide repeats and is located in the chromosome 22 region which is deleted in DiGeorge syndrome. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-MED15 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
86kDa
NCBI Official Full Name
PC2 (positive cofactor 2, multiprotein complex) glutamine/Q-rich-associated protein, isoform CRA_d
NCBI Official Synonym Full Names
mediator complex subunit 15
NCBI Official Symbol
MED15
NCBI Official Synonym Symbols
TIG1; CAG7A; CTG7A; PCQAP; TIG-1; TNRC7; ARC105
NCBI Protein Information
mediator of RNA polymerase II transcription subunit 15
UniProt Protein Name
Mediator of RNA polymerase II transcription subunit 15
UniProt Gene Name
MED15
UniProt Synonym Gene Names
ARC105; CTG7A; PCQAP; TIG1; TNRC7; ARC105; PC2 glutamine/Q-rich-associated protein; TIG-1
UniProt Entry Name
MED15_HUMAN

Similar Products

Product Notes

The MED15 med15 (Catalog #AAA201534) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MED15 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MED15 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the MED15 med15 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TPQSMPPPPQ PSPQPGQPSS QPNSNVSSGP APSPSSFLPS PSPQPSQSPV. It is sometimes possible for the material contained within the vial of "MED15, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.