Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46360_IHC10.jpg IHC (Immunohistochemistry) (Anti- MEK3 Picoband antibody, AAA46360, IHC(P)IHC(P): Human Intestinal Cancer Tissue)

MEK3 Polyclonal Antibody | anti-MEK3 antibody

Anti-MEK3 Antibody

Average rating 0.0
No ratings yet
Gene Names
MAP2K3; MEK3; MKK3; MAPKK3; PRKMK3; SAPKK2; SAPKK-2
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
MEK3, Antibody; Anti-MEK3 Antibody; Dual specificity mitogen-activated protein kinase kinase 3(MAP kinase kinase 3/MAPKK 3); AW212142; Dual specificity mitogen activated protein kinase kinase 3; Dual specificity mitogen-activated protein kinase kinase 3; ERK kinase 3; MAP kinase kinase 3; MAP2K 3; map2k3; MAPK ERK kinase 3; MAPK kinase 3; MAPK/ERK kinase 3; MAPKK 3; MAPKK3; MEK 3; MEK3; Mitogen activated protein kinase kinase 3; MKK 3; MKK3; mMKK 3b; mMKK3b; MP2K3_HUMAN; MPK 3; PRKMK 3; PRKMK3; Protein kinase mitogen activated kinase 3; protein kinase, mitogen-activated, kinase 3; SAPK kinase 2; SAPKK 2; SAPKK2; SKK2; Stress activated protein kinase kinase 2; zMKK 3; mitogen-activated protein kinase kinase 3; anti-MEK3 antibody
Ordering
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
318
Applicable Applications for anti-MEK3 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human MEK3 (311-347aa AERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS), identical to the related mouse sequence.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(Anti- MEK3 Picoband antibody, AAA46360, IHC(P)IHC(P): Human Intestinal Cancer Tissue)

product-image-AAA46360_IHC10.jpg IHC (Immunohistochemistry) (Anti- MEK3 Picoband antibody, AAA46360, IHC(P)IHC(P): Human Intestinal Cancer Tissue)

IHC (Immunohistochemisry)

(Anti- MEK3 Picoband antibody, AAA46360, IHC(P)IHC(P): Rat Skeletal Muscle Tissue)

product-image-AAA46360_IHC11.jpg IHC (Immunohistochemisry) (Anti- MEK3 Picoband antibody, AAA46360, IHC(P)IHC(P): Rat Skeletal Muscle Tissue)

IHC (Immunohiostchemistry)

(Anti- MEK3 Picoband antibody, AAA46360, IHC(P)IHC(P): Mouse Skeletal Muscle Tissue)

product-image-AAA46360_IHC13.jpg IHC (Immunohiostchemistry) (Anti- MEK3 Picoband antibody, AAA46360, IHC(P)IHC(P): Mouse Skeletal Muscle Tissue)

WB (Western Blot)

(Anti- MEK3 Picoband antibody, AAA46360, Western blottingAll lanes: Anti MEK3 (AAA46360) at 0.5ug/mlLane 1: Mouse Spleen Tissue Lysate at 50ugLane 2: HELA Whole Cell Lysate at 40ugPredicted bind size: 40KDObserved bind size: 40KD)

product-image-AAA46360_WB15.jpg WB (Western Blot) (Anti- MEK3 Picoband antibody, AAA46360, Western blottingAll lanes: Anti MEK3 (AAA46360) at 0.5ug/mlLane 1: Mouse Spleen Tissue Lysate at 50ugLane 2: HELA Whole Cell Lysate at 40ugPredicted bind size: 40KDObserved bind size: 40KD)
Related Product Information for anti-MEK3 antibody
Description: Rabbit IgG polyclonal antibody for Dual specificity mitogen-activated protein kinase kinase 3(MAP kinase kinase 3/MAPKK 3)(MAP2K3) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Dual specificity mitogen-activated protein kinase kinase 3 is an enzyme that in humans is encoded by the MAP2K3 gene. The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is activated by mitogenic and environmental stress, and participates in the MAP kinase-mediated signaling cascade. It phosphorylates and thus activates MAPK14/p38-MAPK. And this kinase can be activated by insulin, and is necessary for the expression of glucose transporter. Expression of RAS oncogene is found to result in the accumulation of the active form of this kinase, which thus leads to the constitutive activation of MAPK14, and confers oncogenic transformation of primary cells. Rampoldi et al. (1997) localized the MAP2K3 gene to 17q11.2.
References
1. Rampoldi L, Zimbello R, Bortoluzzi S, Tiso N, Valle G, Lanfranchi G, Danieli GA (Mar 1998). "Chromosomal localization of four MAPK signaling cascade genes: MEK1, MEK3, MEK4 and MEKK5". Cytogenet Cell Genet 78 (3-4): 301-3.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,940 Da
NCBI Official Full Name
dual specificity mitogen-activated protein kinase kinase 3 isoform A
NCBI Official Synonym Full Names
mitogen-activated protein kinase kinase 3
NCBI Official Symbol
MAP2K3
NCBI Official Synonym Symbols
MEK3; MKK3; MAPKK3; PRKMK3; SAPKK2; SAPKK-2
NCBI Protein Information
dual specificity mitogen-activated protein kinase kinase 3
UniProt Protein Name
Dual specificity mitogen-activated protein kinase kinase 3
UniProt Gene Name
MAP2K3
UniProt Synonym Gene Names
MEK3; MKK3; PRKMK3; SKK2; MAP kinase kinase 3; MAPKK 3; MEK 3; SAPK kinase 2; SAPKK-2; SAPKK2
UniProt Entry Name
MP2K3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The MEK3 map2k3 (Catalog #AAA46360) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-MEK3 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MEK3 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the MEK3 map2k3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MEK3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.