Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201601_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: MFGE8Sample Tissue: Human Thymus Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit MFGE8 Polyclonal Antibody | anti-MFGE8 antibody

MFGE8 Antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
MFGE8; BA46; HMFG; MFGM; SED1; hP47; EDIL1; MFG-E8; SPAG10; OAcGD3S; HsT19888
Reactivity
Tested: Human
Predicted: Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MFGE8, Antibody; MFGE8 Antibody - middle region; anti-MFGE8 antibody
Ordering
Host
Rabbit
Reactivity
Tested: Human
Predicted: Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: KEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPG
Sequence Length
312
Applicable Applications for anti-MFGE8 antibody
WB (Western Blot)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MFGE8
Protein Size (#AA)
312 amino acids
Blocking Peptide
For anti-MFGE8 (MBS3221559) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: MFGE8Sample Tissue: Human Thymus Tumor lysatesAntibody Dilution: 1ug/ml)

product-image-AAA201601_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: MFGE8Sample Tissue: Human Thymus Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-MFGE8 antibody
This gene encodes a preproprotein that is proteolytically processed to form multiple protein products. The major encoded protein product, lactadherin, is a membrane glycoprotein that promotes phagocytosis of apoptotic cells. This protein has also been implicated in wound healing, autoimmune disease, and cancer. Lactadherin can be further processed to form a smaller cleavage product, medin, which comprises the major protein component of aortic medial amyloid (AMA). Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-MFGE8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35 kDa
NCBI Official Full Name
lactadherin isoform b
NCBI Official Synonym Full Names
milk fat globule-EGF factor 8 protein
NCBI Official Symbol
MFGE8
NCBI Official Synonym Symbols
BA46; HMFG; MFGM; SED1; hP47; EDIL1; MFG-E8; SPAG10; OAcGD3S; HsT19888
NCBI Protein Information
lactadherin
UniProt Protein Name
Lactadherin
UniProt Gene Name
MFGE8
UniProt Synonym Gene Names
MFG-E8
UniProt Entry Name
MFGM_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The MFGE8 mfge8 (Catalog #AAA201601) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MFGE8 Antibody - middle region reacts with Tested: Human Predicted: Human and may cross-react with other species as described in the data sheet. AAA Biotech's MFGE8 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the MFGE8 mfge8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KEVTGIITQG ARNFGSVQFV ASYKVAYSND SANWTEYQDP RTGSSKIFPG. It is sometimes possible for the material contained within the vial of "MFGE8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.