WB (Western Blot)
(WB Suggested Anti-MFN1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Placenta)
Rabbit MFN1 Polyclonal Antibody | anti-MFN1 antibody
MFN1 antibody - middle region
Gene Names
MFN1; hfzo1; hfzo2
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MFN1, Antibody; MFN1 antibody - middle region; anti-MFN1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QVDITQKQLEEEIARLPKEIDQLEKIQNNSKLLRNKAVQLENELENFTKQ
Sequence Length
741
Applicable Applications for anti-MFN1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MFN1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-MFN1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Placenta)
WB (Western Blot)
(WB Suggested Anti-MFN1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Placenta)
WB (Western Blot)
(Host: MouseTarget Name: MFN1Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: MouseTarget Name: MFN1Sample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)
Related Product Information for anti-MFN1 antibody
This is a rabbit polyclonal antibody against MFN1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The protein encoded by this gene is a mediator of mitochondrial fusion. This protein and mitofusin 2 are homologs of the Drosophila protein fuzzy onion (Fzo). They are mitochondrial membrane proteins that interact with each other to facilitate mitochondrial targeting.
Target Description: The protein encoded by this gene is a mediator of mitochondrial fusion. This protein and mitofusin 2 are homologs of the Drosophila protein fuzzy onion (Fzo). They are mitochondrial membrane proteins that interact with each other to facilitate mitochondrial targeting.
Product Categories/Family for anti-MFN1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
84
NCBI Official Full Name
mitofusin-1
NCBI Official Synonym Full Names
mitofusin 1
NCBI Official Symbol
MFN1
NCBI Official Synonym Symbols
hfzo1; hfzo2
NCBI Protein Information
mitofusin-1
UniProt Protein Name
Mitofusin-1
UniProt Gene Name
Mfn1
UniProt Synonym Gene Names
Fzo1b
UniProt Entry Name
MFN1_RAT
Similar Products
Product Notes
The MFN1 mfn1 (Catalog #AAA200729) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MFN1 antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MFN1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the MFN1 mfn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QVDITQKQLE EEIARLPKEI DQLEKIQNNS KLLRNKAVQL ENELENFTKQ. It is sometimes possible for the material contained within the vial of "MFN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.