Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200270_IHC8.jpg IHC (Immunohistochemistry) (Rabbit Anti-MLKL antibody Catalog Number: ARP53092 Formalin Fixed Paraffin Embedded Tissue: Human Placenta Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec)

Rabbit MLKL Polyclonal Antibody | anti-MLKL antibody

MLKL antibody - N-terminal region

Gene Names
MLKL; hMLKL
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Rat, Cow, Horse
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
MLKL, Antibody; MLKL antibody - N-terminal region; hMLKL; anti-MLKL antibody
Ordering
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Rat, Cow, Horse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: DVWKELSLLLQVEQRMPVSPISQGASWAQEDQQDADEDRRAFQMLRRDNE
Sequence Length
471
Applicable Applications for anti-MLKL antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 85%; Horse: 91%; Human: 100%; Rat: 90%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human MLKL
Protein Size (# AA)
471 amino acids
Blocking Peptide
MLKL peptide ( ) is used for blocking the activity of MLKL antibody (MBS3211122)
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

IHC (Immunohistochemistry)

(Rabbit Anti-MLKL antibody Catalog Number: ARP53092 Formalin Fixed Paraffin Embedded Tissue: Human Placenta Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec)

product-image-AAA200270_IHC8.jpg IHC (Immunohistochemistry) (Rabbit Anti-MLKL antibody Catalog Number: ARP53092 Formalin Fixed Paraffin Embedded Tissue: Human Placenta Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec)

WB (Western Blot)

(25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The canonical isoform of 54 kDa is present as well as a second isoform around ~30 kDa.)

product-image-AAA200270_WB10.jpg WB (Western Blot) (25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The canonical isoform of 54 kDa is present as well as a second isoform around ~30 kDa.)

WB (Western Blot)

(Host: RabbitTarget Name: MLKLSample Type: 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

product-image-AAA200270_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: MLKLSample Type: 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: MLKLSample Tissue: Human Lung TumorAntibody Dilution: 1ug/ml)

product-image-AAA200270_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: MLKLSample Tissue: Human Lung TumorAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: MLKLSample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA200270_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: MLKLSample Tissue: Human 786-0 Whole CellAntibody Dilution: 1ug/ml)
Product Categories/Family for anti-MLKL antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
mixed lineage kinase domain-like protein isoform 1
NCBI Official Synonym Full Names
mixed lineage kinase domain like pseudokinase
NCBI Official Symbol
MLKL
NCBI Official Synonym Symbols
hMLKL
NCBI Protein Information
mixed lineage kinase domain-like protein
UniProt Protein Name
Mixed lineage kinase domain-like protein
UniProt Gene Name
MLKL
UniProt Entry Name
MLKL_HUMAN

Similar Products

Product Notes

The MLKL mlkl (Catalog #AAA200270) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MLKL antibody - N-terminal region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Human, Rat, Cow, Horse and may cross-react with other species as described in the data sheet. AAA Biotech's MLKL can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the MLKL mlkl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DVWKELSLLL QVEQRMPVSP ISQGASWAQE DQQDADEDRR AFQMLRRDNE. It is sometimes possible for the material contained within the vial of "MLKL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.