Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281118_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using MLST8 antibody.)

Rabbit MLST8 Polyclonal Antibody | anti-MLST8 antibody

MLST8 Polyclonal Antibody

Gene Names
MLST8; GBL; LST8; POP3; WAT1; GbetaL
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Western Blot
Purity
Affinity Purification
Synonyms
MLST8, Antibody; MLST8 Polyclonal Antibody; GbetaL; GBL; LST8; POP3; WAT1; anti-MLST8 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.09% Sodium azide,50% glycerol,pH7.3.
Sequence
MNTSPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEVTPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVNKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPEVSITSAHIDPDASYMAAVNSTGNCYVWNLTGGIGDEVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLM
Sequence Length
326
Applicable Applications for anti-MLST8 antibody
IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant protein of human MLST8
Immunogen Species
Human
Cellular Location
Cytoplasm
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of U2OS cells using MLST8 antibody.)

product-image-AAA281118_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using MLST8 antibody.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using MLST8 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.)

product-image-AAA281118_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using MLST8 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.)
Product Categories/Family for anti-MLST8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 23kDa; 28kDa; 35kDa
Observed: 37kDa
NCBI Official Full Name
target of rapamycin complex subunit LST8 isoform a
NCBI Official Synonym Full Names
MTOR associated protein, LST8 homolog
NCBI Official Symbol
MLST8
NCBI Official Synonym Symbols
GBL; LST8; POP3; WAT1; GbetaL
NCBI Protein Information
target of rapamycin complex subunit LST8
UniProt Protein Name
Target of rapamycin complex subunit LST8
UniProt Gene Name
MLST8
UniProt Synonym Gene Names
GBL; LST8; TORC subunit LST8; Gable; Protein GbetaL; mLST8

Similar Products

Product Notes

The MLST8 mlst8 (Catalog #AAA281118) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MLST8 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MLST8 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the MLST8 mlst8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MNTSPGTVGS DPVILATAGY DHTVRFWQAH SGICTRTVQH QDSQVNALEV TPDRSMIAAA GYQHIRMYDL NSNNPNPIIS YDGVNKNIAS VGFHEDGRWM YTGGEDCTAR IWDLRSRNLQ CQRIFQVNAP INCVCLHPNQ AELIVGDQSG AIHIWDLKTD HNEQLIPEPE VSITSAHIDP DASYMAAVNS TGNCYVWNLT GGIGDEVTQL IPKTKIPAHT RYALQCRFSP DSTLLATCSA DQTCKIWRTS NFSLM. It is sometimes possible for the material contained within the vial of "MLST8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.