Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA126280_FCM13.png FCM/FACS (Flow Cytometry) (Figure 2. Flow Cytometry analysis of THP-1 cells using anti-MLX antibody (AAA126280).Overlay histogram showing THP-1 cells stained with AAA126280 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-MLX Antibody (AAA126280, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-rabbit IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

Rabbit MLX Polyclonal Antibody | anti-MLX antibody

Anti-MLX Antibody Picoband

Average rating 0.0
No ratings yet
Gene Names
MLX; MAD7; MXD7; TCFL4; bHLHd13
Reactivity
Human, Monkey, Mouse
Applications
Flow Cytometry, Functional Assay, Western Blot
Purity
Immunogen affinity purified.
Synonyms
MLX, Antibody; Anti-MLX Antibody Picoband; anti-MLX antibody
Ordering
Host
Rabbit
Reactivity
Human, Monkey, Mouse
Clonality
Polyclonal
Isotype
Rabbit IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4.
Concentration
Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml. (varies by lot)
Applicable Applications for anti-MLX antibody
FCM/FACS (Flow Cytometry), WB (Western Blot)
Reconstitution
Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence of human MLX (FQELSACVFSWIEEHCKPQTLREIVIGVLHQLKNQLY).
Preparation and Storage
Store at -20 degree C for one year from date of receipt. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for six months. Avoid repeated freezing and thawing.

FCM/FACS (Flow Cytometry)

(Figure 2. Flow Cytometry analysis of THP-1 cells using anti-MLX antibody (AAA126280).Overlay histogram showing THP-1 cells stained with AAA126280 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-MLX Antibody (AAA126280, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-rabbit IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA126280_FCM13.png FCM/FACS (Flow Cytometry) (Figure 2. Flow Cytometry analysis of THP-1 cells using anti-MLX antibody (AAA126280).Overlay histogram showing THP-1 cells stained with AAA126280 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-MLX Antibody (AAA126280, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-rabbit IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

WB (Western Blot)

(Figure 1. Western blot analysis of MLX using anti-MLX antibody (AAA126280).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.Lane 1: human HepG2 whole cell lysates,Lane 2: human MCF-7 whole cell lysates,Lane 3: human SiHa whole cell lysates,Lane 4: monkey COS-7 whole cell lysates,Lane 5: mouse HEPA1-6 whole cell lysates.After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-MLX antigen affinity purified polyclonal antibody (#AAA126280) at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for MLX at approximately 50 kDa. The expected band size for MLX is at 50 kDa.)

product-image-AAA126280_WB15.jpg WB (Western Blot) (Figure 1. Western blot analysis of MLX using anti-MLX antibody (AAA126280).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.Lane 1: human HepG2 whole cell lysates,Lane 2: human MCF-7 whole cell lysates,Lane 3: human SiHa whole cell lysates,Lane 4: monkey COS-7 whole cell lysates,Lane 5: mouse HEPA1-6 whole cell lysates.After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-MLX antigen affinity purified polyclonal antibody (#AAA126280) at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for MLX at approximately 50 kDa. The expected band size for MLX is at 50 kDa.)
Related Product Information for anti-MLX antibody
Max-like protein X is a protein that in humans is encoded by the MLX gene. The product of this gene belongs to the family of basic helix-loop-helix leucine zipper (bHLH-Zip) transcription factors. These factors form heterodimers with Mad proteins and play a role in proliferation, determination and differentiation. This gene product may act to diversify Mad family function by its restricted association with a subset of the Mad family of transcriptional repressors, namely, Mad1 and Mad4. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.
Product Categories/Family for anti-MLX antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,300 Da
NCBI Official Full Name
max-like protein X isoform gamma
NCBI Official Synonym Full Names
MLX, MAX dimerization protein
NCBI Official Symbol
MLX
NCBI Official Synonym Symbols
MAD7; MXD7; TCFL4; bHLHd13
NCBI Protein Information
max-like protein X; BigMax protein; MAX-like bHLHZIP protein; transcription factor-like protein 4; class D basic helix-loop-helix protein 13
UniProt Protein Name
Max-like protein X
UniProt Gene Name
MLX
UniProt Synonym Gene Names
BHLHD13; TCFL4; bHLHd13
UniProt Entry Name
MLX_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The MLX mlx (Catalog #AAA126280) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-MLX Antibody Picoband reacts with Human, Monkey, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's MLX can be used in a range of immunoassay formats including, but not limited to, FCM/FACS (Flow Cytometry), WB (Western Blot). Researchers should empirically determine the suitability of the MLX mlx for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MLX, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.