<
WB (Western Blot)
(WB Suggested Anti-MMP1 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)
Rabbit anti-Horse, Human MMP1 Polyclonal Antibody | anti-MMP1 antibody
MMP1 antibody - N-terminal region
Gene Names
MMP1; CLG; CLGN
Reactivity
Horse, Human
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
MMP1; Polyclonal Antibody; MMP1 antibody - N-terminal region; anti-MMP1 antibody
Host
Rabbit
Reactivity
Horse, Human
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEF
Sequence Length
469
Applicable Applications for anti-MMP1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Horse: 77%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human MMP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-MMP1 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)
WB (Western Blot)
(WB Suggested Anti-MMP1 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)
WB (Western Blot)
(WB Suggested Anti-MMP1 AntibodyPositive Control: Lane 1: 15ug HT29 cell lysate Lane 2: 15ug HT29 cell lysatePrimary Antibody Dilution : 1:500Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:2000Submitted by: Zhongsheng Peng, School of Medicine, University of Maryland Baltimore)
WB (Western Blot)
(WB Suggested Anti-MMP1 AntibodyPositive Control: Lane 1: 15ug HT29 cell lysate Lane 2: 15ug HT29 cell lysatePrimary Antibody Dilution : 1:500Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:2000Submitted by: Zhongsheng Peng, School of Medicine, University of Maryland Baltimore)
WB (Western Blot)
(Host: RabbitTarget Name: MMP1Sample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: MMP1Sample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Sample Type: Equine cartilage explantsSample Type: Equine Cartilage ExplantsPrimary Dilution: 1:800Secondary Antibody: Bio-Rad 170-5046Secondary Dilution::100,000Image Submitted By: Adam WilliamsUniversity of Nottingham)
WB (Western Blot)
(Sample Type: Equine cartilage explantsSample Type: Equine Cartilage ExplantsPrimary Dilution: 1:800Secondary Antibody: Bio-Rad 170-5046Secondary Dilution::100,000Image Submitted By: Adam WilliamsUniversity of Nottingham)
IHC (Immunohistochemistry)
(species sample : Humancell/tissue :macrophagesHuman macrophagesdilution :1/200)
IHC (Immunohistochemistry)
(species sample : Humancell/tissue :macrophagesHuman macrophagesdilution :1/200)
IHC (Immunohistochemistry)
(Rabbit Anti-MMP1 AntibodyParaffin Embedded Tissue: Human IntestineCellular Data: Epithelial cells of intestinal villasAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
IHC (Immunohistochemistry)
(Rabbit Anti-MMP1 AntibodyParaffin Embedded Tissue: Human IntestineCellular Data: Epithelial cells of intestinal villasAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
IHC (Immunohistochemistry)
(Rabbit Anti-MMP1 AntibodyParaffin Embedded Tissue: Human alveolar cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
IHC (Immunohistochemistry)
(Rabbit Anti-MMP1 AntibodyParaffin Embedded Tissue: Human alveolar cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
IHC (Immunohistochemistry)
(MMP1 in epithelial cells ovarian carcinoma was detected using HRP/DAB brown color stain.Antibody Titration: 2-10ug/mlPositive Control: Human epithelial cells ovarian carcinoma)
IHC (Immunohistochemistry)
(MMP1 in epithelial cells ovarian carcinoma was detected using HRP/DAB brown color stain.Antibody Titration: 2-10ug/mlPositive Control: Human epithelial cells ovarian carcinoma)
IHC (Immunohistochemistry)
(Human Colorectal cancer sampleHuman Liver Sample)
IHC (Immunohistochemistry)
(Human Colorectal cancer sampleHuman Liver Sample)
Related Product Information for anti-MMP1 antibody
This is a rabbit polyclonal antibody against MMP1. It was validated on Western Blot and immunohistochemistry
Target Description: Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. MMP1 is a secreted enzyme which breaks down the interstitial collagens, types I, II, and III.Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This gene encodes a secreted enzyme which breaks down the interstitial collagens, types I, II, and III. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3.
Target Description: Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. MMP1 is a secreted enzyme which breaks down the interstitial collagens, types I, II, and III.Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This gene encodes a secreted enzyme which breaks down the interstitial collagens, types I, II, and III. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3.
Product Categories/Family for anti-MMP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
interstitial collagenase isoform 1 preproprotein
NCBI Official Synonym Full Names
matrix metallopeptidase 1
NCBI Official Symbol
MMP1
NCBI Official Synonym Symbols
CLG; CLGN
NCBI Protein Information
interstitial collagenase
UniProt Protein Name
Interstitial collagenase
UniProt Gene Name
MMP1
UniProt Synonym Gene Names
CLG; MMP-1
UniProt Entry Name
MMP1_HUMAN
Similar Products
Product Notes
The MMP1 mmp1 (Catalog #AAA23500) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MMP1 antibody - N-terminal region reacts with Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's MMP1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the MMP1 mmp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PATLETQEQD VDLVQKYLEK YYNLKNDGRQ VEKRRNSGPV VEKLKQMQEF. It is sometimes possible for the material contained within the vial of "MMP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
