Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46500_IHC11.jpg IHC (Immunohistochemisry) (Anti- MMP-9 Picoband antibody, IHC(P)IHC(P): Rat Liver Tissue)

anti-Mouse, Rat MMP9 Polyclonal Antibody | anti-MMP9 antibody

Anti-MMP9 Antibody

Gene Names
Mmp9; Clg4b; Gel B; MMP-9; B/MMP9; AW743869; pro-MMP-9
Reactivity
Mouse, Rat
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
MMP9, Antibody; Anti-MMP9 Antibody; Matrix metalloproteinase-9; 82 kDa matrix metalloproteinase-9; 92 kDa gelatinase; 92 kDa type IV collagenase; CLG 4B; CLG4B; Collagenase Type 4 beta; Collagenase type IV 92 KD; EC 3.4.24.35; Gelatinase 92 KD; Gelatinase B; Gelatinase beta; GelatinaseB; GELB; Macrophage gelatinase; MANDP2; Matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase); Matrix Metalloproteinase 9; MMP 9; MMP-9; MMP9; MMP9_HUMAN; Type V collagenase; matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase); anti-MMP9 antibody
Ordering
Reactivity
Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
730
Applicable Applications for anti-MMP9 antibody
ELISA, IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of mouse MMP9 (641-672aa KALLFSKGRVWRFDLKSQKVDPQSVIRVDKEF), different from the related human sequence by thirteen amino acids, and from the related rat sequence by eight amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquoted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemisry)

(Anti- MMP-9 Picoband antibody, IHC(P)IHC(P): Rat Liver Tissue)

product-image-AAA46500_IHC11.jpg IHC (Immunohistochemisry) (Anti- MMP-9 Picoband antibody, IHC(P)IHC(P): Rat Liver Tissue)

Application Data

(Anti- MMP-9 Picoband antibody, IHC(P)IHC(P): Mouse Kidney Tissue)

product-image-AAA46500_AD13.jpg Application Data (Anti- MMP-9 Picoband antibody, IHC(P)IHC(P): Mouse Kidney Tissue)

WB (Western Blot)

(Anti- MMP-9 Picoband antibody, Western blottingAll lanes: Anti MMP-9 at 0.5ug/mlLane 1: NRK Whole Cell Lysate at 40ugLane 2: ANA-1 Whole Cell Lysate at 40ugLane 3: HEPA Whole Cell Lysate at 40ugPredicted bind size: 78KDObserved bind size: 78KD)

product-image-AAA46500_WB15.jpg WB (Western Blot) (Anti- MMP-9 Picoband antibody, Western blottingAll lanes: Anti MMP-9 at 0.5ug/mlLane 1: NRK Whole Cell Lysate at 40ugLane 2: ANA-1 Whole Cell Lysate at 40ugLane 3: HEPA Whole Cell Lysate at 40ugPredicted bind size: 78KDObserved bind size: 78KD)
Related Product Information for anti-MMP9 antibody
Description: Rabbit IgG polyclonal antibody for Matrix metalloproteinase-9(MMP9) detection. Tested with WB, IHC-P, ELISA in Mouse;Rat.

Background: Matrix metallopeptidase 9 (MMP-9), also known as 92 kDa type IV collagenase, 92 kDa gelatinase or gelatinase B (GELB), is an enzyme that in humans is encoded by the MMP9 gene. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades type IV and V collagens. Studies in rhesus monkeys suggest that the enzyme is involved in IL-8-induced mobilization of hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling.
References
1. Template:, 92kDa type IV collagenase). 2. Yuichiro Hirose et al. (May 2008). "A Functional Polymorphism in THBS2 that Affects Alternative Splicing and MMP Binding Is Associated with Lumbar-Disc Herniation".

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
80,535 Da
NCBI Official Full Name
matrix metalloproteinase-9 preproprotein
NCBI Official Synonym Full Names
matrix metallopeptidase 9
NCBI Official Symbol
Mmp9
NCBI Official Synonym Symbols
Clg4b; Gel B; MMP-9; B/MMP9; AW743869; pro-MMP-9
NCBI Protein Information
matrix metalloproteinase-9
UniProt Protein Name
Matrix metalloproteinase-9
UniProt Gene Name
Mmp9
UniProt Synonym Gene Names
Clg4b; MMP-9; GELB
UniProt Entry Name
MMP9_MOUSE

Similar Products

Product Notes

The MMP9 mmp9 (Catalog #AAA46500) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-MMP9 Antibody reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MMP9 can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the MMP9 mmp9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MMP9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.