Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281664_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded Rat ovary using MRPL30 Rabbit pAb at dilution of 1:100 (40x lens).)

Rabbit anti-Human, Rat MRPL30 Polyclonal Antibody | anti-MRPL30 antibody

MRPL30 Rabbit pAb

Gene Names
MRPL30; L28MT; L30MT; MRPL28; RPML28; MRP-L28; MRP-L30; MRPL28M
Reactivity
Human, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
MRPL30, Antibody; MRPL30 Rabbit pAb; MRPL30; L28MT; L30MT; MRP-L28; MRP-L30; MRPL28; MRPL28M; RPML28; anti-MRPL30 antibody
Ordering
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MAGILRLVVQWPPGRLQTVTKGVESLICTDWIRHKFTRSRIPEKVFQASPEDHEKYGGDPQNPHKLHIVTRIKSTRRRPYWEKDIIKMLGLEKAHTPQVHKNIPSVNAKLKVVKHLIRIKPLKLPQGLPAEENMSNTCLKSTGELVVQWHLKPVEQKAHES
Applicable Applications for anti-MRPL30 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-161 of human MRPL30 (NP_660213.1).
Cellular Location
Mitochondrion
Positive Samples
HeLa, U-251MG, 293T
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded Rat ovary using MRPL30 Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA281664_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded Rat ovary using MRPL30 Rabbit pAb at dilution of 1:100 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded Human breast cancer using MRPL30 Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA281664_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded Human breast cancer using MRPL30 Rabbit pAb at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using MRPL30 Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

product-image-AAA281664_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using MRPL30 Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Related Product Information for anti-MRPL30 antibody
Background: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Alternative splicing results in multiple transcript variants. Pseudogenes corresponding to this gene are found on chromosomes 6p and 12p. Read-through transcription also exists between this gene and the neighboring upstream lipoyltransferase 1 (LIPT1) gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18,546 Da
NCBI Official Full Name
39S ribosomal protein L30, mitochondrial
NCBI Official Synonym Full Names
mitochondrial ribosomal protein L30
NCBI Official Symbol
MRPL30
NCBI Official Synonym Symbols
L28MT; L30MT; MRPL28; RPML28; MRP-L28; MRP-L30; MRPL28M
NCBI Protein Information
39S ribosomal protein L30, mitochondrial; 39S ribosomal protein L28, mitochondrial
UniProt Protein Name
39S ribosomal protein L30, mitochondrial
UniProt Gene Name
MRPL30
UniProt Synonym Gene Names
MRPL28; RPML28; HSPC249; L30mt; MRP-L30; L28mt; MRP-L28
UniProt Entry Name
RM30_HUMAN

Similar Products

Product Notes

The MRPL30 mrpl30 (Catalog #AAA281664) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MRPL30 Rabbit pAb reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MRPL30 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the MRPL30 mrpl30 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAGILRLVVQ WPPGRLQTVT KGVESLICTD WIRHKFTRSR IPEKVFQASP EDHEKYGGDP QNPHKLHIVT RIKSTRRRPY WEKDIIKMLG LEKAHTPQVH KNIPSVNAKL KVVKHLIRIK PLKLPQGLPA EENMSNTCLK STGELVVQWH LKPVEQKAHE S. It is sometimes possible for the material contained within the vial of "MRPL30, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.