Rabbit anti-Human MRPS21 Polyclonal Antibody | anti-MRPS21 antibody

MRPS21 Rabbit pAb

Cat. Num. AAA283286

• Reactivity: Human
• Applications: ELISA, Immunohistochemistry
• Purity: Affinity purification
• Synonyms: MRPS21, Antibody; MRPS21 Rabbit pAb; bS21m; MDS016; RPMS21; MRP-S21; anti-MRPS21 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
• Sequence: MAKHLKFIARTVMVQEGNVESAYRTLNRILTMDGLIEDIKHRRYYEKPCCRRQRESYERCRRIYNMEMARKINFLMRKNRADPWQGC

• Applicable Applications for anti-MRPS21 antibody: ELISA, IHC (Immunohistochemistry)
• Cross Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-87 of human MRPS21(NP_114107.2).
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human colon tissue using MRPS21 Rabbit pAb (AAA283286) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemisry)

(Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using MRPS21 Rabbit pAb (AAA283286) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohiostchemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using MRPS21 Rabbit pAb (AAA283286) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using MRPS21 Rabbit pAb (AAA283286) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.)

Related Product Information for anti-MRPS21 antibody

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S21P family. Pseudogenes corresponding to this gene are found on chromosomes 1p, 1q, 9p, 10p, 10q, 16q, and 17q. Available sequence data analyses identified splice variants that differ in the 5' UTR; both transcripts encode the same protein.

Product Categories/Family for anti-MRPS21 antibody

Epigenetics and Nuclear Signaling; Chromosome Structure; Cohesins; DNA Damage Response; Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 16950593
• NCBI GeneID: 54460
• NCBI Accession #: NP_061870.1
• NCBI GenBank Nucleotide #: NM_018997.2
• UniProt Accession #: P82921; Q5TB11; Q9BST6
• Molecular Weight: Calculated MW: 10kDa
• UniProt Protein Name: 28S ribosomal protein S21, mitochondrial
• UniProt Gene Name: MRPS21
• UniProt Synonym Gene Names: RPMS21; MRP-S21; S21mt
• UniProt Entry Name: RT21_HUMAN