Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282402_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using MST1/STK4 Rabbit pAb (AAA282402) at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit MST1/MST1/MST1/MST1/STK4 Polyclonal Antibody | anti-MST1/MST1/MST1/MST1/STK4 antibody

MST1/MST1/MST1/MST1/STK4 Rabbit pAb

Gene Names
STK4; KRS2; MST1; YSK3
Reactivity
Human, Mouse, Rat
Applications
Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
MST1/MST1/MST1/MST1/STK4, Antibody; MST1/MST1/MST1/MST1/STK4 Rabbit pAb; KRS2; MST1; YSK3; anti-MST1/MST1/MST1/MST1/STK4 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
Liquid
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
KRQESQQREVDQDDEENSEEDEMDSGTMVRAVGDEMGTVRVASTMTDGANTMIEHDDTLPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAKKRRQQNF
Applicable Applications for anti-MST1/MST1/MST1/MST1/STK4 antibody
ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Positive Samples
HeLa, Mouse lung
Cellular Location
Cytoplasm, Nucleus
Research Area
Signal Transduction, Kinase, Serine threonine kinases, Cell Biology Developmental Biology, Apoptosis, Autophagy, Cardiovascular, Heart, Hypertrophy
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 303-487 of human MST1/MST1/MST1/MST1/STK4 (NP_006273.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Ship: Ice Pack

IF (Immunofluorescence)

(Immunofluorescence analysis of L929 cells using MST1/STK4 Rabbit pAb (AAA282402) at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA282402_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using MST1/STK4 Rabbit pAb (AAA282402) at dilution of 1:100. Blue: DAPI for nuclear staining.)

IHC (Immunohiostchemistry)

(Immunohistochemistry analysis of paraffin-embedded human breast cancer using MST1/STK4 antibody (AAA282402) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

product-image-AAA282402_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry analysis of paraffin-embedded human breast cancer using MST1/STK4 antibody (AAA282402) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using MST1/MST1/MST1/MST1/STK4 Rabbit pAb (AAA282402) at1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s.)

product-image-AAA282402_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using MST1/MST1/MST1/MST1/STK4 Rabbit pAb (AAA282402) at1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s.)
Related Product Information for anti-MST1/MST1/MST1/MST1/STK4 antibody
The protein encoded by this gene is a cytoplasmic kinase that is structurally similar to the yeast Ste20p kinase, which acts upstream of the stress-induced mitogen-activated protein kinase cascade. The encoded protein can phosphorylate myelin basic protein and undergoes autophosphorylation. A caspase-cleaved fragment of the encoded protein has been shown to be capable of phosphorylating histone H2B. The particular phosphorylation catalyzed by this protein has been correlated with apoptosis, and it's possible that this protein induces the chromatin condensation observed in this process.
Product Categories/Family for anti-MST1/MST1/MST1/MST1/STK4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
52,335 Da
NCBI Official Full Name
Serine/threonine-protein kinase 4
NCBI Official Synonym Full Names
serine/threonine kinase 4
NCBI Official Symbol
STK4
NCBI Official Synonym Symbols
KRS2; MST1; YSK3
NCBI Protein Information
serine/threonine-protein kinase 4
UniProt Protein Name
Serine/threonine-protein kinase 4
UniProt Gene Name
STK4
UniProt Synonym Gene Names
KRS2; MST1; MST-1; MST1/N; MST1/C

Similar Products

Product Notes

The MST1/MST1/MST1/MST1/STK4 stk4 (Catalog #AAA282402) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MST1/MST1/MST1/MST1/STK4 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MST1/MST1/MST1/MST1/STK4 can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the MST1/MST1/MST1/MST1/STK4 stk4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KRQESQQREV DQDDEENSEE DEMDSGTMVR AVGDEMGTVR VASTMTDGAN TMIEHDDTLP SQLGTMVINA EDEEEEGTMK RRDETMQPAK PSFLEYFEQK EKENQINSFG KSVPGPLKNS SDWKIPQDGD YEFLKSWTVE DLQKRLLALD PMMEQEIEEI RQKYQSKRQP ILDAIEAKKR RQQNF. It is sometimes possible for the material contained within the vial of "MST1/MST1/MST1/MST1/STK4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.