Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201258_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: MstnSample Type: Mouse Brain lysatesAntibody Dilution: 1.0ug/ml)

Rabbit Mstn Polyclonal Antibody | anti-MSTN antibody

Mstn Antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
Mstn; Cmpt; Gdf8
Reactivity
Predicted: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Mstn, Antibody; Mstn Antibody - C-terminal region; anti-MSTN antibody
Ordering
Host
Rabbit
Reactivity
Predicted: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence Length
376
Applicable Applications for anti-MSTN antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%;
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Mstn
Immunogen Sequence
Synthetic peptide located within the following region: APKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPIN
Protein Size (# AA)
376 amino acids
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: MstnSample Type: Mouse Brain lysatesAntibody Dilution: 1.0ug/ml)

product-image-AAA201258_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: MstnSample Type: Mouse Brain lysatesAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: GDF8Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

product-image-AAA201258_WB15.jpg WB (Western Blot) (Host: MouseTarget Name: GDF8Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)
Related Product Information for anti-MSTN antibody
This is a rabbit polyclonal antibody against Mstn. It was validated on Western Blot

Target Description: Mstn acts specifically as a negative regulator of skeletal muscle growth.
Product Categories/Family for anti-MSTN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
growth/differentiation factor 8 preproprotein
NCBI Official Synonym Full Names
myostatin
NCBI Official Symbol
Mstn
NCBI Official Synonym Symbols
Cmpt; Gdf8
NCBI Protein Information
growth/differentiation factor 8
UniProt Protein Name
Growth/differentiation factor 8
UniProt Gene Name
Mstn
UniProt Synonym Gene Names
Gdf8; GDF-8

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The MSTN mstn (Catalog #AAA201258) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Mstn Antibody - C-terminal region reacts with Predicted: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's Mstn can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the MSTN mstn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Mstn, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.