Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282341_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using MT-ND4L antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit anti-Mouse, Rat MT-ND4L Polyclonal Antibody | anti-MT-ND4L antibody

MT-ND4L Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
CCNH; CAK; p34; p37
Reactivity
Mouse, Rat
Applications
Immunocytochemistry, Immunofluorescence
Purity
Affinity purification
Synonyms
MT-ND4L, Antibody; MT-ND4L Rabbit pAb; MTND4L; MT-ND4L; anti-MT-ND4L antibody
Ordering
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.01% thiomersal, 50% glycerol, pH7.3.
Sequence
MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPILENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL
Applicable Applications for anti-MT-ND4L antibody
ICC (Immunocytochemistry), IF (Immunofluorescence)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 40 to the C-terminus of human MT-ND4L (AXQ02532.1).
Cellular Location
mitochondrial inner membrane, mitochondrial respiratory chain complex I
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of L929 cells using MT-ND4L antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA282341_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of L929 cells using MT-ND4L antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of C6 cells using MT-ND4L antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA282341_IF15.jpg IF (Immunofluorescence) (Immunofluorescence analysis of C6 cells using MT-ND4L antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
Related Product Information for anti-MT-ND4L antibody
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
902
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,643 Da
NCBI Official Full Name
cyclin-H isoform 1
NCBI Official Synonym Full Names
cyclin H
NCBI Official Symbol
CCNH
NCBI Official Synonym Symbols
CAK; p34; p37
NCBI Protein Information
cyclin-H; CAK complex subunit; MO15-associated protein; CDK-activating kinase complex subunit; cyclin-dependent kinase-activating kinase complex subunit
UniProt Protein Name
Cyclin-H
UniProt Gene Name
CCNH
UniProt Entry Name
CCNH_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The MT-ND4L ccnh (Catalog #AAA282341) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MT-ND4L Rabbit pAb reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MT-ND4L can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IF (Immunofluorescence). Researchers should empirically determine the suitability of the MT-ND4L ccnh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MYHNSSQKRH WTFSSEEQLA RLRADANRKF RCKAVANGKV LPNDPVFLEP HEEMTLCKYY EKRLLEFCSV FKPAMPRSVV GTACMYFKRF YLNNSVMEYH PRIIMLTCAF LACKVDEFNV SSPQFVGNLR ESPLGQEKAL EQILEYELLL IQQLNFHLIV HNPYRPFEGF LIDLKTRYPI LENPEILRKT ADDFLNRIAL TDAYLLYTPS QIALTAILSS ASRAGITMES YLSESLMLKE NRTCLSQLLD IMKSMRNLVK KYEPPRSEEV AVLKQKLERC HSAELALNVI TKKRKGYEDD DYVSKKSKHE EEEWTDDDLV ESL. It is sometimes possible for the material contained within the vial of "MT-ND4L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.