Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282389_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of PC-12 cells using MTAP Rabbit pAb (AAA282389) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit MTAP Polyclonal Antibody | anti-MTAP antibody

MTAP Rabbit pAb

Gene Names
MTAP; BDMF; MSAP; DMSFH; LGMBF; DMSMFH; c86fus; HEL-249
Reactivity
Human, Mouse, Rat
Applications
Immunocytochemistry, Immunofluorescence
Purity
Affinity purification
Synonyms
MTAP, Antibody; MTAP Rabbit pAb; BDMF; MSAP; DMSFH; LGMBF; DMSMFH; c86fus; HEL-249; anti-MTAP antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
Liquid
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLPRH
Applicable Applications for anti-MTAP antibody
ICC (Immunocytochemistry), IF (Immunofluorescence)
Positive Samples
HT-29, NIH/3T3
Cellular Location
Cytoplasm, Nucleus
Research Area
Cancer, Signal Transduction, Endocrine Metabolism, Amino acid metabolism
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-283 of human MTAP (NP_002442.2).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Ship: Ice Pack

IF (Immunofluorescence)

(Immunofluorescence analysis of PC-12 cells using MTAP Rabbit pAb (AAA282389) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA282389_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of PC-12 cells using MTAP Rabbit pAb (AAA282389) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH/3T3 cells using MTAP Rabbit pAb (AAA282389) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA282389_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH/3T3 cells using MTAP Rabbit pAb (AAA282389) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of HeLa cells using MTAP Rabbit pAb (AAA282389) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA282389_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of HeLa cells using MTAP Rabbit pAb (AAA282389) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of various lysates, using MTAP Rabbit pAb (AAA282389) at 1:400 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s.)

product-image-AAA282389_WB15.jpg WB (Western Blot) (Western blot analysis of various lysates, using MTAP Rabbit pAb (AAA282389) at 1:400 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s.)
Related Product Information for anti-MTAP antibody
This gene encodes an enzyme that plays a major role in polyamine metabolism and is important for the salvage pathway of both adenine and methionine. The encoded enzyme is deficient in many cancers. Multiple alternatively spliced transcript variants have been described for this gene.
Product Categories/Family for anti-MTAP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,278 Da
NCBI Official Full Name
S-methyl-5'-thioadenosine phosphorylase
NCBI Official Synonym Full Names
methylthioadenosine phosphorylase
NCBI Official Symbol
MTAP
NCBI Official Synonym Symbols
BDMF; MSAP; DMSFH; LGMBF; DMSMFH; c86fus; HEL-249
NCBI Protein Information
S-methyl-5'-thioadenosine phosphorylase; 5'-methylthioadenosine phosphorylase; MTA phosphorylase; MTAP; MTAPase; MeSAdo phosphorylase; epididymis luminal protein 249
UniProt Protein Name
S-methyl-5'-thioadenosine phosphorylase
UniProt Gene Name
MTAP
UniProt Entry Name
MTAP_HUMAN

Similar Products

Product Notes

The MTAP mtap (Catalog #AAA282389) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MTAP Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MTAP can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IF (Immunofluorescence). Researchers should empirically determine the suitability of the MTAP mtap for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MASGTTTTAV KIGIIGGTGL DDPEILEGRT EKYVDTPFGK PSDALILGKI KNVDCVLLAR HGRQHTIMPS KVNYQANIWA LKEEGCTHVI VTTACGSLRE EIQPGDIVII DQFIDRTTMR PQSFYDGSHS CARGVCHIPM AEPFCPKTRE VLIETAKKLG LRCHSKGTMV TIEGPRFSSR AESFMFRTWG ADVINMTTVP EVVLAKEAGI CYASIAMATD YDCWKEHEEA VSVDRVLKTL KENANKAKSL LLTTIPQIGS TEWSETLHNL KNMAQFSVLL PRH. It is sometimes possible for the material contained within the vial of "MTAP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.