Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28400_IF6.jpg IF (Immunofluorescence) (Immunofluorescence analysis of Mouse colon using MUC2 Rabbit pAb (AAA28400) at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit MUC2 Polyclonal Antibody | anti-MUC2 antibody

MUC2 Rabbit pAb

Gene Names
MUC2; MLP; SMUC; MUC-2
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity purification
Synonyms
MUC2, Antibody; MUC2 Rabbit pAb; MUC2; MLP; MUC-2; SMUC; mucin-2; anti-MUC2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
Liquid. PBS with 0.02% sodium azide, 50% glycerol, pH7.3
Sequence
LCAQQNICLDWRNHTHGACLVECPSHREYQACGPAEEPTCKSSSSQQNNTVLVEGCFCPEGTMNYAPGFDVCVKTCGCVGPDNVPREFGEHFEFDCKNCVC
Applicable Applications for anti-MUC2 antibody
WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:200
IF: 1:50-1:200
Customer validation: (Human bone marrow cancer cell, Human chronic myeloid leukemia cells), IHC (Mus musculus, Rattus norvegicus), WB (Mus musculus), IF (Mus musculus)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 4850-4950 of human MUC2 (NP_002448.4).
Positive Samples
HT-29, Mouse small intestine, Rat large intestine, Rat small intestine
Cellular Location
Secreted
Research Area
Cancer, Tumor immunology, Tumor-associated antigens
Cancer, Invasion and Metastasis
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of Mouse colon using MUC2 Rabbit pAb (AAA28400) at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA28400_IF6.jpg IF (Immunofluorescence) (Immunofluorescence analysis of Mouse colon using MUC2 Rabbit pAb (AAA28400) at dilution of 1:100. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of Rat rectum using MUC2 Rabbit pAb (AAA28400) at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA28400_IF5.jpg IF (Immunofluorescence) (Immunofluorescence analysis of Rat rectum using MUC2 Rabbit pAb (AAA28400) at dilution of 1:100. Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human colon using MUC2 Rabbit pAb (AAA28400) at dilution of 1:100 (40x lens).)

product-image-AAA28400_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human colon using MUC2 Rabbit pAb (AAA28400) at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat ovary using MUC2 Rabbit pAb (AAA28400) at dilution of 1:100 (40x lens).)

product-image-AAA28400_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat ovary using MUC2 Rabbit pAb (AAA28400) at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using MUC2 antibody (AAA28400) at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 180s.)

product-image-AAA28400_WB2.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using MUC2 antibody (AAA28400) at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 180s.)

WB (Western Blot)

(Western blot analysis of extracts of HT-29 cells, using MUC2 antibody (AAA28400) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 180s.)

product-image-AAA28400_WB.jpg WB (Western Blot) (Western blot analysis of extracts of HT-29 cells, using MUC2 antibody (AAA28400) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 180s.)
Related Product Information for anti-MUC2 antibody
This gene encodes a member of the mucin protein family. Mucins are high molecular weight glycoproteins produced by many epithelial tissues. The protein encoded by this gene is secreted and forms an insoluble mucous barrier that protects the gut lumen. The protein polymerizes into a gel of which 80% is composed of oligosaccharide side chains by weight. The protein features a central domain containing tandem repeats rich in threonine and proline that varies between 50 and 115 copies in different individuals. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known.
Product Categories/Family for anti-MUC2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
540,300 Da
NCBI Official Full Name
mucin-2
NCBI Official Synonym Full Names
mucin 2, oligomeric mucus/gel-forming
NCBI Official Symbol
MUC2
NCBI Official Synonym Symbols
MLP; SMUC; MUC-2
NCBI Protein Information
mucin-2; intestinal mucin-2; mucin-like protein; mucin 2, intestinal/tracheal
UniProt Protein Name
Mucin-2
UniProt Gene Name
MUC2
UniProt Synonym Gene Names
SMUC; MUC-2
UniProt Entry Name
MUC2_HUMAN

Similar Products

Product Notes

The MUC2 muc2 (Catalog #AAA28400) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MUC2 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MUC2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence). WB: 1:500-1:2000 IHC: 1:50-1:200 IF: 1:50-1:200 Customer validation: (Human bone marrow cancer cell, Human chronic myeloid leukemia cells), IHC (Mus musculus, Rattus norvegicus), WB (Mus musculus), IF (Mus musculus). Researchers should empirically determine the suitability of the MUC2 muc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LCAQQNICLD WRNHTHGACL VECPSHREYQ ACGPAEEPTC KSSSSQQNNT VLVEGCFCPE GTMNYAPGFD VCVKTCGCVG PDNVPREFGE HFEFDCKNCV C. It is sometimes possible for the material contained within the vial of "MUC2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.