Application Data
MUC4 blocking peptide
MUC4 Peptide - middle region
Gene Names
MUC4; ASGP; MUC-4; HSA276359
Reactivity
Tested Reactivity: Human (Predicted Reactivity: Human)
Applications
Western Blot
Purity
Affinity purified
Synonyms
MUC4, Blocking Peptide; MUC4 Peptide - middle region; MUC4 blocking peptide
Host
Rabbit
Reactivity
Tested Reactivity: Human (Predicted Reactivity: Human)
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: VWNNNPEDDFRMPNGSTIPPGSPEEMLFHFGMTWQINGTGLLGKRNDQLP
Sequence Length
1125 amino acids
Applicable Applications for MUC4 blocking peptide
WB (Western Blot)
Protein Size (#AA)
1125 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MUC4
Quality control
The peptide is characterized by mass spectroscopy.
Preparation and Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Application Data
Application Data
Related Product Information for MUC4 blocking peptide
This is a synthetic peptide designed for use in combination with anti- MUC4 Antibody, made
Target Description: The major constituents of mucus, the viscous secretion that covers epithelial surfaces such as those in the trachea, colon, and cervix, are highly glycosylated proteins called mucins. These glycoproteins play important roles in the protection of the epithelial cells and have been implicated in epithelial renewal and differentiation. This gene encodes an integral membrane glycoprotein found on the cell surface, although secreted isoforms may exist. At least two dozen transcript variants of this gene have been found, although for many of them the full-length transcript has not been determined or they are found only in tumor tissues. This gene contains a region in the coding sequence which has a variable number (>100) of 48 nt tandem repeats.
Target Description: The major constituents of mucus, the viscous secretion that covers epithelial surfaces such as those in the trachea, colon, and cervix, are highly glycosylated proteins called mucins. These glycoproteins play important roles in the protection of the epithelial cells and have been implicated in epithelial renewal and differentiation. This gene encodes an integral membrane glycoprotein found on the cell surface, although secreted isoforms may exist. At least two dozen transcript variants of this gene have been found, although for many of them the full-length transcript has not been determined or they are found only in tumor tissues. This gene contains a region in the coding sequence which has a variable number (>100) of 48 nt tandem repeats.
Product Categories/Family for MUC4 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
123 kDa
NCBI Official Full Name
mucin-4 isoform d
NCBI Official Synonym Full Names
mucin 4, cell surface associated
NCBI Official Symbol
MUC4
NCBI Official Synonym Symbols
ASGP; MUC-4; HSA276359
NCBI Protein Information
mucin-4
UniProt Protein Name
Mucin-4
UniProt Gene Name
MUC4
UniProt Synonym Gene Names
MUC-4; ASGP; ASGP-1; ASGP-2
UniProt Entry Name
MUC4_HUMAN
Similar Products
Product Notes
The MUC4 muc4 (Catalog #AAA201861) is a Blocking Peptide produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MUC4 Peptide - middle region reacts with Tested Reactivity: Human (Predicted Reactivity: Human) and may cross-react with other species as described in the data sheet. AAA Biotech's MUC4 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the MUC4 muc4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VWNNNPEDDF RMPNGSTIPP GSPEEMLFHF GMTWQINGTG LLGKRNDQLP. It is sometimes possible for the material contained within the vial of "MUC4, Polyclonal Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.