Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46230_IHC10.jpg IHC (Immunohistochemistry) (Anti- Munc18-1 Picoband antibody, AAA46230, IHC(P)IHC(P): Human Glioma Tissue)

Munc18-1 Polyclonal Antibody | anti-STXBP1 antibody

Anti-Munc18-1 Antibody

Average rating 0.0
No ratings yet
Gene Names
STXBP1; P67; NSEC1; UNC18; RBSEC1; MUNC18-1
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
Munc18-1, Antibody; Anti-Munc18-1 Antibody; Syntaxin-binding protein 1; FLJ37475; Munc 18 1; Munc 18a; MUNC18 1; N-Sec1; Neuronal SEC1; NSec1; p67; Protein unc-18 homolog 1; Protein unc-18 homolog A; Rb sec1; RBSEC1; STXB1_HUMAN; STXBP1; Syntaxin binding protein 1; Unc 18 homolog; Unc 18A; Unc-18A; Unc18 1; UNC18; Unc18-1; syntaxin binding protein 1; anti-STXBP1 antibody
Ordering
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
594
Applicable Applications for anti-STXBP1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Munc18-1 (184-216aa KEYPAVRYRGEYKDNALLAQLIQDKLDAYKADD), identical to the related mouse and rat sequences.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(Anti- Munc18-1 Picoband antibody, AAA46230, IHC(P)IHC(P): Human Glioma Tissue)

product-image-AAA46230_IHC10.jpg IHC (Immunohistochemistry) (Anti- Munc18-1 Picoband antibody, AAA46230, IHC(P)IHC(P): Human Glioma Tissue)

IHC (Immunohistochemisry)

(Anti- Munc18-1 Picoband antibody, AAA46230, IHC(P)IHC(P): Rat Brain Tissue)

product-image-AAA46230_IHC11.jpg IHC (Immunohistochemisry) (Anti- Munc18-1 Picoband antibody, AAA46230, IHC(P)IHC(P): Rat Brain Tissue)

IHC (Immunohiostchemistry)

(Anti- Munc18-1 Picoband antibody, AAA46230, IHC(P)IHC(P): Mouse Brain Tissue)

product-image-AAA46230_IHC13.jpg IHC (Immunohiostchemistry) (Anti- Munc18-1 Picoband antibody, AAA46230, IHC(P)IHC(P): Mouse Brain Tissue)

WB (Western Blot)

(Anti- Munc18-1 Picoband antibody, AAA46230, Western blottingAll lanes: Anti Munc18-1 (AAA46230) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Brain Tissue Lysate at 50ugLane 3: PANC Whole Cell Lysate at 40ugLane 4: HEPG2 Whole Cell Lysate at 40ugLane 5: HELA Whole Cell Lysate at 40ugPredicted bind size: 67KDObserved bind size: 67KD)

product-image-AAA46230_WB15.jpg WB (Western Blot) (Anti- Munc18-1 Picoband antibody, AAA46230, Western blottingAll lanes: Anti Munc18-1 (AAA46230) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Brain Tissue Lysate at 50ugLane 3: PANC Whole Cell Lysate at 40ugLane 4: HEPG2 Whole Cell Lysate at 40ugLane 5: HELA Whole Cell Lysate at 40ugPredicted bind size: 67KDObserved bind size: 67KD)
Related Product Information for anti-STXBP1 antibody
Description: Rabbit IgG polyclonal antibody for Syntaxin-binding protein 1(STXBP1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Syntaxin-binding protein 1, also known as Munc18-1, is a protein that in humans is encoded by the STXBP1 gene. By fluorescence in situ hybridization, the STXBP1 gene is mapped to chromosome 9q34.1. This gene encodes a syntaxin-binding protein. The encoded protein appears to play a role in release of neurotransmitters via regulation of syntaxin, a transmembrane attachment protein receptor. Mutations in this gene have been associated with infantile epileptic encephalopathy-4. Alternatively spliced transcript variants have been described.
References
1. "Entrez Gene: STXBP1 syntaxin binding protein 1". 2. Fisher, R. J., Pevsner, J., Burgoyne, R. D. Control of fusion pore dynamics during exocytosis by Munc18. Science 291: 875-878, 2001. 3. Swanson DA, Steel JM, Valle D (Jun 1998). "Identification and characterization of the human ortholog of rat STXBP1, a protein implicated in vesicle trafficking and neurotransmitter release". Genomics 48 (3): 373-6.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68,736 Da
NCBI Official Full Name
syntaxin-binding protein 1 isoform b
NCBI Official Synonym Full Names
syntaxin binding protein 1
NCBI Official Symbol
STXBP1
NCBI Official Synonym Symbols
P67; NSEC1; UNC18; RBSEC1; MUNC18-1
NCBI Protein Information
syntaxin-binding protein 1
UniProt Protein Name
Syntaxin-binding protein 1
UniProt Gene Name
STXBP1
UniProt Synonym Gene Names
UNC18A; Unc18-1; Unc-18A
UniProt Entry Name
STXB1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The STXBP1 stxbp1 (Catalog #AAA46230) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-Munc18-1 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Munc18-1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the STXBP1 stxbp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Munc18-1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.