Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199652_IHC11.jpg IHC (Immunohistochemisry) (Rabbit Anti-MX1 antibodyCatalog Number: AAA199652Formalin Fixed Paraffin Embedded Tissue: Human HeartPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Rabbit MX1 Polyclonal Antibody | anti-MX1 antibody

MX1 antibody - C-terminal region

Gene Names
MX1; MX; MxA; IFI78; IFI-78K
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
MX1, Antibody; MX1 antibody - C-terminal region; anti-MX1 antibody
Ordering
Host
Rabbit
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
KAMLQLLQDKDTYSWLLKERSDTSDKRKFLKERLARLTQARRRLAQFPG
Applicable Applications for anti-MX1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Protein Size (# AA)
662 amino acids
Protein Interactions
MX1; CAB39L; SIAH1; UBC; APP; ISG15; TRPC7; TRPC3; TRPC1; TRPC4; BLM; TRPC6; DAXX; TRPC5; TUBB; ACTB; PIAS1; SUMO1; SP100; FANCA;
Blocking Peptide
For anti-MX1 (MBS3208037) antibody is Catalog # MBS3233000
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human MX1
Replacement Item
This antibody may replace item sc-110081 from Santa Cruz Biotechnology.
Predicted Homology
Cow: 86%; Dog: 100%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 86%; Rat: 93%; Sheep: 86%
Preparation and Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

IHC (Immunohistochemisry)

(Rabbit Anti-MX1 antibodyCatalog Number: AAA199652Formalin Fixed Paraffin Embedded Tissue: Human HeartPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

product-image-AAA199652_IHC11.jpg IHC (Immunohistochemisry) (Rabbit Anti-MX1 antibodyCatalog Number: AAA199652Formalin Fixed Paraffin Embedded Tissue: Human HeartPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

WB (Western Blot)

(MX1 antibody - C-terminal region validated by WB using human LCL at 1:1000.)

product-image-AAA199652_WB13.jpg WB (Western Blot) (MX1 antibody - C-terminal region validated by WB using human LCL at 1:1000.)

WB (Western Blot)

(Host: RabbitTarget Name: MX1Sample Tissue: Human 786-0Antibody Dilution: 1.0ug/ml)

product-image-AAA199652_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: MX1Sample Tissue: Human 786-0Antibody Dilution: 1.0ug/ml)
Related Product Information for anti-MX1 antibody
In mouse, the interferon-inducible Mx protein is responsible for a specific antiviral state against influenza virus infection. MX1 is similar to the mouse protein as determined by its antigenic relatedness, induction conditions, physicochemical properties, and amino acid analysis. This cytoplasmic protein is a member of both the dynamin family and the family of large GTPases. In mouse, the interferon-inducible Mx protein is responsible for a specific antiviral state against influenza virus infection. The protein encoded by this gene is similar to the mouse protein as determined by its antigenic relatedness, induction conditions, physicochemical properties, and amino acid analysis. This cytoplasmic protein is a member of both the dynamin family and the family of large GTPases. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-MX1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75kDa
NCBI Official Full Name
interferon-induced GTP-binding protein Mx1 isoform a
NCBI Official Synonym Full Names
MX dynamin like GTPase 1
NCBI Official Symbol
MX1
NCBI Official Synonym Symbols
MX; MxA; IFI78; IFI-78K
NCBI Protein Information
interferon-induced GTP-binding protein Mx1
UniProt Protein Name
Interferon-induced GTP-binding protein Mx1
UniProt Gene Name
MX1
UniProt Synonym Gene Names
IFI-78K
UniProt Entry Name
MX1_HUMAN

Similar Products

Product Notes

The MX1 mx1 (Catalog #AAA199652) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MX1 antibody - C-terminal region reacts with Tested Reactivity: Human Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's MX1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the MX1 mx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KAMLQLLQDK DTYSWLLKER SDTSDKRKFL KERLARLTQA RRRLAQFPG. It is sometimes possible for the material contained within the vial of "MX1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.