Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197160_WB10.jpg WB (Western Blot) (WB Suggested Anti-MXI1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)

Rabbit MXI1 Polyclonal Antibody | anti-MXI1 antibody

MXI1 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
MXI1; MXI; MAD2; MXD2; bHLHc11
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
MXI1, Antibody; MXI1 antibody - middle region; anti-MXI1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LNKAKAHIKKLEEAERKSQHQLENLEREQRFLKWRLEQLQGPQEMERIRM
Sequence Length
295
Applicable Applications for anti-MXI1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 75%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MXI1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-MXI1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)

product-image-AAA197160_WB10.jpg WB (Western Blot) (WB Suggested Anti-MXI1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)

WB (Western Blot)

(Host: MouseTarget Name: MXI1Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

product-image-AAA197160_WB11.jpg WB (Western Blot) (Host: MouseTarget Name: MXI1Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

IHC (Immunohiostchemistry)

(Rabbit Anti-MXI1 AntibodyParaffin Embedded Tissue: Human LungCellular Data: Epithelial cells of bronchioleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA197160_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-MXI1 AntibodyParaffin Embedded Tissue: Human LungCellular Data: Epithelial cells of bronchioleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(IHC Suggested Anti-MXI1 antibodyTitration: 5ug/ mlPositive Control: Lung, respiratory epithelium)

product-image-AAA197160_IHC15.jpg IHC (Immunohistochemistry) (IHC Suggested Anti-MXI1 antibodyTitration: 5ug/ mlPositive Control: Lung, respiratory epithelium)
Related Product Information for anti-MXI1 antibody
This is a rabbit polyclonal antibody against MXI1. It was validated on Western Blot and immunohistochemistry

Target Description: Expression of the c-myc gene, which produces an oncogenic transcription factor, is tightly regulated in normal cells but is frequently deregulated in human cancers. The MXI1 gene encodes a transcriptional repressor protein thought to negatively regulate MYC function, and is therefore a potential tumor suppressor. This protein inhibits the transcriptional activity of MYC by competing for MAX, another basic helix-loop-helix protein that binds to MYC and is required for its function. Defects in MXI1 are frequently found in patients with prostate tumors.Expression of the c-myc gene, which produces an oncogenic transcription factor, is tightly regulated in normal cells but is frequently deregulated in human cancers. The protein encoded by this gene is a transcriptional repressor thought to negatively regulate MYC function, and is therefore a potential tumor suppressor. This protein inhibits the transcriptional activity of MYC by competing for MAX, another basic helix-loop-helix protein that binds to MYC and is required for its function. Defects in this gene are frequently found in patients with prostate tumors. Three alternatively spliced transcripts encoding different isoforms have been described. Additional alternatively spliced transcripts may exist but the products of these transcripts have not been verified experimentally.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
max-interacting protein 1 isoform b
NCBI Official Synonym Full Names
MAX interactor 1, dimerization protein
NCBI Official Symbol
MXI1
NCBI Official Synonym Symbols
MXI; MAD2; MXD2; bHLHc11
NCBI Protein Information
max-interacting protein 1
UniProt Protein Name
Max-interacting protein 1
UniProt Gene Name
MXI1
UniProt Synonym Gene Names
BHLHC11; Max interactor 1; bHLHc11
UniProt Entry Name
MXI1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The MXI1 mxi1 (Catalog #AAA197160) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MXI1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's MXI1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the MXI1 mxi1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LNKAKAHIKK LEEAERKSQH QLENLEREQR FLKWRLEQLQ GPQEMERIRM. It is sometimes possible for the material contained within the vial of "MXI1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.