Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281786_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH/3T3 cells using MYOG antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit MYOG Polyclonal Antibody | anti-MYOG antibody

MYOG Rabbit pAb

Gene Names
MYOG; MYF4; myf-4; bHLHc3
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
MYOG, Antibody; MYOG Rabbit pAb; MYOG; MYF4; bHLHc3; myf-4; myogenin; Myogenin; anti-MYOG antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPEAPGPLEDKGLGTPEHCPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN
Applicable Applications for anti-MYOG antibody
IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-1-224 of human MYOG (NP_002470.2).
Cellular Location
Nucleus
Positive Samples
RD
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.09% Sodium azide,50% glycerol,pH7.3.

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH/3T3 cells using MYOG antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA281786_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH/3T3 cells using MYOG antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of RD cells, using MYOG antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)

product-image-AAA281786_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of RD cells, using MYOG antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)
Related Product Information for anti-MYOG antibody
Background: Myogenin is a muscle-specific transcription factor that can induce myogenesis in a variety of cell types in tissue culture. It is a member of a large family of proteins related by sequence homology, the helix-loop-helix (HLH) proteins. It is essential for the development of functional skeletal muscle.
Product Categories/Family for anti-MYOG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
myogenin
NCBI Official Synonym Full Names
myogenin (myogenic factor 4)
NCBI Official Symbol
MYOG
NCBI Official Synonym Symbols
MYF4; myf-4; bHLHc3
NCBI Protein Information
myogenin; myogenic factor 4; class C basic helix-loop-helix protein 3
UniProt Protein Name
Myogenin
UniProt Gene Name
MYOG
UniProt Synonym Gene Names
BHLHC3; MYF4; bHLHc3; Myf-4
UniProt Entry Name
MYOG_HUMAN

Similar Products

Product Notes

The MYOG myog (Catalog #AAA281786) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MYOG Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MYOG can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the MYOG myog for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MELYETSPYF YQEPRFYDGE NYLPVHLQGF EPPGYERTEL TLSPEAPGPL EDKGLGTPEH CPGQCLPWAC KVCKRKSVSV DRRRAATLRE KRRLKKVNEA FEALKRSTLL NPNQRLPKVE ILRSAIQYIE RLQALLSSLN QEERDLRYRG GGGPQPGVPS ECSSHSASCS PEWGSALEFS ANPGDHLLTA DPTDAHNLHS LTSIVDSITV EDVSVAFPDE TMPN. It is sometimes possible for the material contained within the vial of "MYOG, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.