Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46227_IHC11.jpg IHC (Immunohistochemisry) (Anti- NDRG2 Picoband antibody, AAA46227, IHC(P)IHC(P): Rat Brain Tissue)

NDRG2 Polyclonal Antibody | anti-NDRG2 antibody

Anti-NDRG2 Antibody

Average rating 0.0
No ratings yet
Gene Names
NDRG2; SYLD
Reactivity
Mouse, Rat
Predicted to work with: Human
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
NDRG2, Antibody; Anti-NDRG2 Antibody; Protein NDRG2; Antidepressant related protein ADRG123; Cytoplasmic protein Ndr1; DKFZp781G1938; FLJ25522; KIAA1248; N myc downstream regulated gene 2; N myc downstream regulator 2; NDR1 related protein NDR2; NDRG 2; NDRG family member 2; NDRG1 related protein; NDRG2; NDRG2_HUMAN; Protein Syld709613; SYLD; Syld709613 protein antibody; anti-NDRG2 antibody
Ordering
Reactivity
Mouse, Rat
Predicted to work with: Human
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
367
Applicable Applications for anti-NDRG2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human NDRG2 (210-247aa NSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFER), different from the related mouse and rat sequences by three amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemisry)

(Anti- NDRG2 Picoband antibody, AAA46227, IHC(P)IHC(P): Rat Brain Tissue)

product-image-AAA46227_IHC11.jpg IHC (Immunohistochemisry) (Anti- NDRG2 Picoband antibody, AAA46227, IHC(P)IHC(P): Rat Brain Tissue)

IHC (Immunohiostchemistry)

(Anti- NDRG2 Picoband antibody, AAA46227, IHC(P)IHC(P): Mouse Brain Tissue)

product-image-AAA46227_IHC13.jpg IHC (Immunohiostchemistry) (Anti- NDRG2 Picoband antibody, AAA46227, IHC(P)IHC(P): Mouse Brain Tissue)

WB (Western Blot)

(Anti- NDRG2 Picoband antibody, AAA46227, Western blottingAll lanes: Anti NDRG2 (AAA46227) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Brain Tissue Lysate at 50ugPredicted bind size: 41KDObserved bind size: 41KD)

product-image-AAA46227_WB15.jpg WB (Western Blot) (Anti- NDRG2 Picoband antibody, AAA46227, Western blottingAll lanes: Anti NDRG2 (AAA46227) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Brain Tissue Lysate at 50ugPredicted bind size: 41KDObserved bind size: 41KD)
Related Product Information for anti-NDRG2 antibody
Description: Rabbit IgG polyclonal antibody for Protein NDRG2(NDRG2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Protein NDRG2, also known as KIAA1248, is a protein that in humans is encoded by the NDRG2 gene. It is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. This gene is mapped to 14q11.2. The protein encoded by this gene is a cytoplasmic protein that may play a role in neurite outgrowth. This gene may be involved in glioblastoma carcinogenesis. It contributes to the regulation of the WNT signaling pathway. Also, this gene may be involved in dendritic cell and neuron differentiation.
References
1. Kalaydjieva, L., Gresham, D., Gooding, R., Heather, L., Baas, F., de Jonge, R., Blechschmidt, K., Angelicheva, D., Chandler, D., Worsley, P., Rosenthal, A., King, R. H. M., Thomas, P. K. N-myc downstream-regulated gene 1 is mutated in hereditary motor and sensory neuropathy-Lom. Am. J. Hum. Genet. 67: 47-58, 2000. 2. Li, Y., Yang, J., Li, S., Zhang, J., Zheng, J., Hou, W., Zhao, H., Guo, Y., Liu, X., Dou, K., Situ, Z., Yao, L. N-myc downstream-regulated gene 2, a novel estrogen-targeted gene, is involved in the regulation of Na+/K(+)-ATPase. J. Biol. Chem. 286: 32289-32299, 2011.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
40,297 Da
NCBI Official Full Name
protein NDRG2 isoform c
NCBI Official Synonym Full Names
NDRG family member 2
NCBI Official Symbol
NDRG2
NCBI Official Synonym Symbols
SYLD
NCBI Protein Information
protein NDRG2
UniProt Protein Name
Protein NDRG2
UniProt Gene Name
NDRG2
UniProt Synonym Gene Names
KIAA1248; SYLD
UniProt Entry Name
NDRG2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The NDRG2 ndrg2 (Catalog #AAA46227) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-NDRG2 Antibody reacts with Mouse, Rat Predicted to work with: Human and may cross-react with other species as described in the data sheet. AAA Biotech's NDRG2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the NDRG2 ndrg2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NDRG2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.