Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200632_WB11.jpg WB (Western Blot) (WB Suggested Anti-NDUFS1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Fetal Liver)

Rabbit NDUFS1 Polyclonal Antibody | anti-NDUFS1 antibody

NDUFS1 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
NDUFS1; CI-75k; MC1DN5; CI-75Kd; PRO1304
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NDUFS1, Antibody; NDUFS1 antibody - middle region; anti-NDUFS1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIE
Sequence Length
727
Applicable Applications for anti-NDUFS1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 93%; Goat: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NDUFS1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-NDUFS1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Fetal Liver)

product-image-AAA200632_WB11.jpg WB (Western Blot) (WB Suggested Anti-NDUFS1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Fetal Liver)

WB (Western Blot)

(Lanes:Lane1: 30 ug Human liverLane2: 30 ug Rat liverLane3: 30 ug Mouse (wild-type) liverLane4: 30 ug Mouse [AMPK alpha 1/2(-/-)] liverLane5: 30 ug Human muscleLane6: 30 ug Rat muscleLane7: 30 ug Mouse musclePrimary Antibody Dilution:1:1000Secondary Antibody:Secondary Antibody Dilution:1:10000Gene Name:NDUFS1Submitted by:Dr. Bruno Guigas, PhD, Dept. of Molecular Cell Biology, Leiden University Medical Center)

product-image-AAA200632_WB13.jpg WB (Western Blot) (Lanes:Lane1: 30 ug Human liverLane2: 30 ug Rat liverLane3: 30 ug Mouse (wild-type) liverLane4: 30 ug Mouse [AMPK alpha 1/2(-/-)] liverLane5: 30 ug Human muscleLane6: 30 ug Rat muscleLane7: 30 ug Mouse musclePrimary Antibody Dilution:1:1000Secondary Antibody:Secondary Antibody Dilution:1:10000Gene Name:NDUFS1Submitted by:Dr. Bruno Guigas, PhD, Dept. of Molecular Cell Biology, Leiden University Medical Center)

WB (Western Blot)

(Human nuclear lysates)

product-image-AAA200632_WB15.jpg WB (Western Blot) (Human nuclear lysates)
Related Product Information for anti-NDUFS1 antibody
This is a rabbit polyclonal antibody against NDUFS1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The protein encoded by this gene belongs to the complex I 75 kDa subunit family. Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. This protein is the largest subunit of complex I and it is a component of the iron-sulfur (IP) fragment of the enzyme. It may form part of the active site crevice where NADH is oxidized. Mutations in this gene are associated with complex I deficiency.
Product Categories/Family for anti-NDUFS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
77kDa
NCBI Official Full Name
NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial isoform 1
NCBI Official Synonym Full Names
NADH:ubiquinone oxidoreductase core subunit S1
NCBI Official Symbol
NDUFS1
NCBI Official Synonym Symbols
CI-75k; MC1DN5; CI-75Kd; PRO1304
NCBI Protein Information
NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
UniProt Protein Name
NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
UniProt Gene Name
NDUFS1
UniProt Synonym Gene Names
CI-75kD
UniProt Entry Name
NDUS1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The NDUFS1 ndufs1 (Catalog #AAA200632) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NDUFS1 antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's NDUFS1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the NDUFS1 ndufs1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TPPGLAREDW KIIRALSEIA GMTLPYDTLD QVRNRLEEVS PNLVRYDDIE. It is sometimes possible for the material contained within the vial of "NDUFS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.