Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281598_IF8.jpg IF (Immunofluorescence) (Immunofluorescence analysis of C6 cells using NeuN Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

Rabbit NeuN Polyclonal Antibody | anti-NeuN antibody

NeuN Rabbit pAb

Gene Names
RBFOX3; FOX3; NEUN; FOX-3; HRNBP3
Reactivity
Human, Mouse, Rat
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
NeuN, Antibody; NeuN Rabbit pAb; FOX-3; FOX3; HRNBP3; NEUN; NeuN; RBFOX3; anti-NeuN antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQSSENSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVGAVYGPELYAA
Applicable Applications for anti-NeuN antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human NeuN (NP_001076045.1).
Cellular Location
Cytoplasm, Nucleus
Positive Samples
U-251MG
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of C6 cells using NeuN Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA281598_IF8.jpg IF (Immunofluorescence) (Immunofluorescence analysis of C6 cells using NeuN Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse brain using NeuN antibody at dilution of 1:100 (40x lens).)

product-image-AAA281598_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse brain using NeuN antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded mouse spinal cord using NeuN antibody at dilution of 1:100 (40x lens).)

product-image-AAA281598_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded mouse spinal cord using NeuN antibody at dilution of 1:100 (40x lens).)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded rat brain using NeuN antibody at dilution of 1:100 (40x lens).)

product-image-AAA281598_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded rat brain using NeuN antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of U-251MG cells, using NeuN antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

product-image-AAA281598_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of U-251MG cells, using NeuN antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-NeuN antibody
Background: This gene encodes a member of the RNA-binding FOX protein family which is involved in the regulation of alternative splicing of pre-mRNA. The protein has an N-terminal proline-rich region, an RNA recognition motif (RRM) domain, and a C-terminal alanine-rich region. This gene produces the neuronal nuclei (NeuN) antigen that has been widely used as a marker for post-mitotic neurons. This gene has its highest expression in the central nervous system and plays a prominent role in neural tissue development and regulation of adult brain function. Mutations in this gene have been associated with numerous neurological disorders. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated MW: 33kDa/35kDa
Observed MW: 50kDa
NCBI Official Full Name
RNA binding protein fox-1 homolog 3
NCBI Official Synonym Full Names
RNA binding protein, fox-1 homolog (C. elegans) 3
NCBI Official Symbol
RBFOX3
NCBI Official Synonym Symbols
FOX3; NEUN; FOX-3; HRNBP3
NCBI Protein Information
RNA binding protein fox-1 homolog 3; fox-1 homolog C; neuronal nuclei; hexaribonucleotide binding protein 3
UniProt Protein Name
RNA binding protein fox-1 homolog 3
UniProt Gene Name
RBFOX3
UniProt Entry Name
RFOX3_HUMAN

Similar Products

Product Notes

The NeuN rbfox3 (Catalog #AAA281598) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NeuN Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NeuN can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the NeuN rbfox3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEKKKMVTQG NQEPTTTPDA MVQPFTTIPF PPPPQNGIPT EYGVPHTQDY AGQTGEHNLT LYGSTQAHGE QSSNSPSTQN GSLTTEGGAQ TDGQQSQTQS SENSESKSTP KRLHVSNIPF RFRDPDLRQM FGQFGKILDV EIIFNERGSK GFGFVTFENS ADADRAREKL HGTVVEGRKI EVNNATARVM TNKKMVTPYA NGWKLSPVVG AVYGPELYAA. It is sometimes possible for the material contained within the vial of "NeuN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.