WB (Western Blot)
(Neuroplastin antibody (AAA224303) used at 5 ug/ml to detect target protein.)
Rabbit Neuroplastin Polyclonal Antibody | anti-Nptn antibody
Neuroplastin antibody
Gene Names
Nptn; Sdfr1
Reactivity
Human, Mouse, Rat, Dog
Applications
Immunohistochemistry, Western Blot
Purity
Total IgG Protein A purified
Synonyms
Neuroplastin, Antibody; Neuroplastin antibody; Polyclonal Neuroplastin; Anti-Neuroplastin; GP65; np65; DKFZp686L2477; MGC102805; np55; GP55; NPTN; SDR1; SDFR1; anti-Nptn antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat, Dog
Clonality
Polyclonal
Specificity
Neuroplastin antibody was raised against the middle region of NPTN
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of NPTN antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
393
Applicable Applications for anti-Nptn antibody
IHC (Immunohistochemistry), WB (Western Blot)
Biological Significance
Neuroplastin is a type I transmembrane protein belonging to the Ig superfamily. The protein is believed to be involved in cell-cell interactions or cell-substrate interactions. The alpha and beta transcripts show differential localization within the brain.
Cross-Reactivity
Human,Mouse,Rat,Dog
Immunogen
Neuroplastin antibody was raised using the middle region of NPTN corresponding to a region with amino acids MEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKN
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
WB (Western Blot)
(Neuroplastin antibody (AAA224303) used at 5 ug/ml to detect target protein.)
WB (Western Blot)
(Neuroplastin antibody (AAA224303) used at 5 ug/ml to detect target protein.)
IHC (Immunohistochemistry)
(Neuroplastin antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X)
IHC (Immunohistochemistry)
(Neuroplastin antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X)
Related Product Information for anti-Nptn antibody
Rabbit polyclonal Neuroplastin antibody raised against the middle region of NPTN
Product Categories/Family for anti-Nptn antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42 kDa (MW of target protein)
NCBI Official Full Name
neuroplastin
NCBI Official Synonym Full Names
neuroplastin
NCBI Official Symbol
Nptn
NCBI Official Synonym Symbols
Sdfr1
NCBI Protein Information
neuroplastin
UniProt Protein Name
Neuroplastin
UniProt Gene Name
Nptn
UniProt Synonym Gene Names
Sdfr1; Sdr1; gp55/65; SDR-1
UniProt Entry Name
NPTN_RAT
Similar Products
Product Notes
The Nptn nptn (Catalog #AAA224303) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Neuroplastin antibody reacts with Human, Mouse, Rat, Dog and may cross-react with other species as described in the data sheet. AAA Biotech's Neuroplastin can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the Nptn nptn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Neuroplastin, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.