Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA162576_IHC13.jpg IHC (Immunohiostchemistry) (NFKB1/NF-Kappa-B Antibody-Anti-NF-KappaB p105 antibody IHC of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody dilution 5-10 ug/ml. This image was taken for the unconjugated form of this product. Other forms have not been tested.)

Rabbit NFKB1/NF-Kappa-B Polyclonal Antibody | anti-NFKB1 antibody

NFKB1/NF-Kappa-B Rabbit anti-Human Polyclonal (N-Terminus) Antibody

Average rating 0.0
No ratings yet
Gene Names
NFKB1; p50; KBF1; p105; EBP-1; NF-kB1; NFKB-p50; NFkappaB; NF-kappaB; NFKB-p105; NF-kappa-B
Reactivity
Chicken, Human
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry
Purity
Affinity purified
Synonyms
NFKB1/NF-Kappa-B, Antibody; NFKB1/NF-Kappa-B Rabbit anti-Human Polyclonal (N-Terminus) Antibody; IHC-plus NFKB1/NF-Kappa-B Antibody (N-Terminus); NFKB1; Ebp- 1; EBP-1; NF-KappaB p50; NFkappaB; NFKB-p50; KBF1; NF-kappa-B; NF-kappaB; NF-kB1; NFKB-p105; p105; p50; DNA binding factor KBF1; DNA-binding factor KBF1; NF-kappabeta; anti-NFKB1 antibody
Ordering
Host
Rabbit
Reactivity
Chicken, Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Human NFKB1
Purity/Purification
Affinity purified
Form/Format
PBS, 0.09% sodium azide, 2% sucrose
Concentration
0.5mg/ml (varies by lot)
Applicable Applications for anti-NFKB1 antibody
WB (Western Blot), IHC (Immunohistochemistry), IHC (Immunohistochemistry)
Target
Human NFKB1/NF-Kappa-B
Immunogen
Synthetic peptide from N-Terminus of human NFKB1 (P19838, NP_003989, aa 11-60) within the region PEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYV. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Dog, Bovine, Bat, Horse, Pig, Opossum, Guinea pig (100%); Rabbit, Turkey, Zebra finch, Chicken (92%); Stickleback, Zebrafish (85%); Salmon (84%).
Conjugation
Unconjugated
Epitope
N-Terminus
Family
Apoptosis
Preparation and Storage
Short term: Store at 2-8 degree C. Long term: Aliquot and store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohiostchemistry)

(NFKB1/NF-Kappa-B Antibody-Anti-NF-KappaB p105 antibody IHC of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody dilution 5-10 ug/ml. This image was taken for the unconjugated form of this product. Other forms have not been tested.)

product-image-AAA162576_IHC13.jpg IHC (Immunohiostchemistry) (NFKB1/NF-Kappa-B Antibody-Anti-NF-KappaB p105 antibody IHC of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody dilution 5-10 ug/ml. This image was taken for the unconjugated form of this product. Other forms have not been tested.)

WB (Western Blot)

(NFKB1/NF-Kappa-B Antibody-Fetal Thymus Lysate. This image was taken for the unconjugated form of this product. Other forms have not been tested.)

product-image-AAA162576_WB15.jpg WB (Western Blot) (NFKB1/NF-Kappa-B Antibody-Fetal Thymus Lysate. This image was taken for the unconjugated form of this product. Other forms have not been tested.)
Related Product Information for anti-NFKB1 antibody
NF-Kappa-B antibody is an unconjugated rabbit polyclonal antibody to NF-Kappa-B (NFKB1)(N-Terminus) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB. Tested on 20 paraffin-embedded human tissues.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
85,520 Da
NCBI Official Full Name
nuclear factor NF-kappa-B p105 subunit isoform 1
NCBI Official Synonym Full Names
nuclear factor of kappa light polypeptide gene enhancer in B-cells 1
NCBI Official Symbol
NFKB1
NCBI Official Synonym Symbols
p50; KBF1; p105; EBP-1; NF-kB1; NFKB-p50; NFkappaB; NF-kappaB; NFKB-p105; NF-kappa-B
NCBI Protein Information
nuclear factor NF-kappa-B p105 subunit; NF-kappabeta; DNA binding factor KBF1; DNA-binding factor KBF1; nuclear factor NF-kappa-B p50 subunit; nuclear factor kappa-B DNA binding subunit
UniProt Protein Name
Nuclear factor NF-kappa-B p105 subunit
UniProt Gene Name
NFKB1
UniProt Entry Name
NFKB1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The NFKB1 nfkb1 (Catalog #AAA162576) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NFKB1/NF-Kappa-B Rabbit anti-Human Polyclonal (N-Terminus) Antibody reacts with Chicken, Human and may cross-react with other species as described in the data sheet. AAA Biotech's NFKB1/NF-Kappa-B can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the NFKB1 nfkb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NFKB1/NF-Kappa-B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.