<
WB (Western Blot)
(WB Suggested Anti-NFKB2 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)
Rabbit NFKB2 Polyclonal Antibody | anti-NFKB2 antibody
NFKB2 antibody - C-terminal region
Gene Names
NFKB2; p52; p100; H2TF1; LYT10; CVID10; LYT-10; NF-kB2; p49/p100
Reactivity
Cow, Horse, Human, Pig, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
NFKB2, Antibody; NFKB2 antibody - C-terminal region; anti-NFKB2 antibody
Host
Rabbit
Reactivity
Cow, Horse, Human, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SDSDSDSEGPEKDTRSSFRGHTPLDLTCSTLVKTLLLNAAQNTMEPPL
Sequence Length
900
Applicable Applications for anti-NFKB2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 77%; Horse: 85%; Human: 100%; Pig: 77%; Rabbit: 92%; Rat: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human NFKB2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-NFKB2 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)
WB (Western Blot)
(WB Suggested Anti-NFKB2 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)
WB (Western Blot)
(Host: RabbitTarget Name: NFKB2Sample Tissue: Human HCT116Antibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: NFKB2Sample Tissue: Human HCT116Antibody Dilution: 1.0ug/ml)
IHC (Immunohiostchemistry)
(Human Smooth Muscle)
IHC (Immunohiostchemistry)
(Human Smooth Muscle)
IHC (Immunohistochemistry)
(Human Muscle)
IHC (Immunohistochemistry)
(Human Muscle)
Related Product Information for anti-NFKB2 antibody
This is a rabbit polyclonal antibody against NFKB2. It was validated on Western Blot and immunohistochemistry
Target Description: NFKB has been detected in numerous cell types that express cytokines, chemokines, growth factors, cell adhesion molecules, and some acute phase proteins in health and in various disease states. NFKB is activated by a wide variety of stimuli such as cytokines, oxidant-free radicals, inhaled particles, ultraviolet irradiation, and bacterial or viral products. Inappropriate activation of NF-kappa-B has been linked to inflammatory events associated with autoimmune arthritis, asthma, septic shock, lung fibrosis, glomerulonephritis, atherosclerosis, and AIDS. In contrast, complete and persistent inhibition of NF-kappa-B has been linked directly to apoptosis, inappropriate immune cell development, and delayed cell growth.
Target Description: NFKB has been detected in numerous cell types that express cytokines, chemokines, growth factors, cell adhesion molecules, and some acute phase proteins in health and in various disease states. NFKB is activated by a wide variety of stimuli such as cytokines, oxidant-free radicals, inhaled particles, ultraviolet irradiation, and bacterial or viral products. Inappropriate activation of NF-kappa-B has been linked to inflammatory events associated with autoimmune arthritis, asthma, septic shock, lung fibrosis, glomerulonephritis, atherosclerosis, and AIDS. In contrast, complete and persistent inhibition of NF-kappa-B has been linked directly to apoptosis, inappropriate immune cell development, and delayed cell growth.
Product Categories/Family for anti-NFKB2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
97kDa
NCBI Official Full Name
nuclear factor NF-kappa-B p100 subunit isoform a
NCBI Official Synonym Full Names
nuclear factor kappa B subunit 2
NCBI Official Symbol
NFKB2
NCBI Official Synonym Symbols
p52; p100; H2TF1; LYT10; CVID10; LYT-10; NF-kB2; p49/p100
NCBI Protein Information
nuclear factor NF-kappa-B p100 subunit
UniProt Protein Name
Nuclear factor NF-kappa-B p100 subunit
UniProt Gene Name
NFKB2
UniProt Synonym Gene Names
LYT10; Lyt10
UniProt Entry Name
NFKB2_HUMAN
Similar Products
Product Notes
The NFKB2 nfkb2 (Catalog #AAA197277) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NFKB2 antibody - C-terminal region reacts with Cow, Horse, Human, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NFKB2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the NFKB2 nfkb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SDSDSDSEGP EKDTRSSFRG HTPLDLTCST LVKTLLLNAA QNTMEPPL. It is sometimes possible for the material contained within the vial of "NFKB2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.