Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201792_WB11.jpg WB (Western Blot) (WB Suggested Anti-NFKBIA Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)

Rabbit anti-Human, Pig NFKBIA Polyclonal Antibody | anti-NFKBIA antibody

NFKBIA antibody - N-terminal region

Gene Names
NFKBIA; IKBA; MAD-3; NFKBI; EDAID2
Reactivity
Human, Pig
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
NFKBIA, Antibody; NFKBIA antibody - N-terminal region; anti-NFKBIA antibody
Ordering
Host
Rabbit
Reactivity
Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQ
Sequence Length
317
Applicable Applications for anti-NFKBIA antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Human: 100%; Pig: 76%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NFKBIA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-NFKBIA Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)

product-image-AAA201792_WB11.jpg WB (Western Blot) (WB Suggested Anti-NFKBIA Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)

IHC (Immunohiostchemistry)

(Rabbit Anti-NFKBIA AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA201792_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-NFKBIA AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: N/AOther Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

IHC (Immunohistochemistry)

(Rabbit Anti-NFKBIA antibodyParaffin Embedded Tissue: Human Brain cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA201792_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-NFKBIA antibodyParaffin Embedded Tissue: Human Brain cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-NFKBIA antibody
This is a rabbit polyclonal antibody against NFKBIA. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: NFKB1 or NFKB2 is bound to REL, RELA, or RELB to form the NFKB complex. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA or NFKBIB), which inactivate NF-kappa-B by trapping it in the cytoplasm. Phosphorylation of serine residues on the I-kappa-B proteins by kinases (IKBKA, or IKBKB) marks them for destruction via the ubiquitination pathway, thereby allowing activation of the NF-kappa-B complex. Activated NFKB complex translocates into the nucleus and binds DNA at kappa-B-binding motifs such as 5-prime GGGRNNYYCC 3-prime or 5-prime HGGARNYYCC 3-prime (where H is A, C, or T; R is an A or G purine; and Y is a C or T pyrimidine).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
NF-kappa-B inhibitor alpha
NCBI Official Synonym Full Names
NFKB inhibitor alpha
NCBI Official Symbol
NFKBIA
NCBI Official Synonym Symbols
IKBA; MAD-3; NFKBI; EDAID2
NCBI Protein Information
NF-kappa-B inhibitor alpha
UniProt Protein Name
NF-kappa-B inhibitor alpha
UniProt Gene Name
NFKBIA
UniProt Synonym Gene Names
IKBA; MAD3; NFKBI; IkB-alpha
UniProt Entry Name
IKBA_HUMAN

Similar Products

Product Notes

The NFKBIA nfkbia (Catalog #AAA201792) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NFKBIA antibody - N-terminal region reacts with Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's NFKBIA can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the NFKBIA nfkbia for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MFQAAERPQE WAMEGPRDGL KKERLLDDRH DSGLDSMKDE EYEQMVKELQ. It is sometimes possible for the material contained within the vial of "NFKBIA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.