Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197822_WB13.jpg WB (Western Blot) (WB Suggested Anti-NFKBIB Antibody Titration: 5.0ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysateNFKBIB is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Rabbit NFKBIB Polyclonal Antibody | anti-NFKBIB antibody

NFKBIB antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
NFKBIB; IKBB; TRIP9
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
NFKBIB, Antibody; NFKBIB antibody - C-terminal region; anti-NFKBIB antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MLRPNPILARLLRAHGAPEPEGEDEKSGPCSSSSDSDSGDEGDEYDDIVV
Sequence Length
356
Applicable Applications for anti-NFKBIB antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 91%; Dog: 83%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 85%; Rabbit: 77%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human NFKBIB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-NFKBIB Antibody Titration: 5.0ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysateNFKBIB is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

product-image-AAA197822_WB13.jpg WB (Western Blot) (WB Suggested Anti-NFKBIB Antibody Titration: 5.0ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysateNFKBIB is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

IHC (Immunohistochemistry)

(Human Intestine)

product-image-AAA197822_IHC15.jpg IHC (Immunohistochemistry) (Human Intestine)
Related Product Information for anti-NFKBIB antibody
This is a rabbit polyclonal antibody against NFKBIB. It was validated on Western Blot and immunohistochemistry

Target Description: NFKB1 (MIM 164011) or NFKB2 (MIM 164012) is bound to REL (MIM 164910), RELA (MIM 164014), or RELB (MIM 604758) to form the NFKB complex. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA, MIM 164008, or NFKBIB), which inactivate NF-kappa-B by trapping it in the cytoplasm. Phosphorylation of serine residues on the I-kappa-B proteins by kinases (IKBKA, MIM 600664 or IKBKB, MIM 603258) marks them for destruction via the ubiquitination pathway, thereby allowing activation of the NF-kappa-B complex. Activated NFKB complex translocates into the nucleus and binds DNA at kappa-B-binding motifs such as 5-prime GGGRNNYYCC 3-prime or 5-prime HGGARNYYCC 3-prime (where H is A, C, or T; R is an A or G purine; and Y is a C or T pyrimidine).[supplied by OMIM].NFKB1 (MIM 164011) or NFKB2 (MIM 164012) is bound to REL (MIM 164910), RELA (MIM 164014), or RELB (MIM 604758) to form the NFKB complex. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA, MIM 164008, or NFKBIB), which inactivate NF-kappa-B by trapping it in the cytoplasm. Phosphorylation of serine residues on the I-kappa-B proteins by kinases (IKBKA, MIM 600664 or IKBKB, MIM 603258) marks them for destruction via the ubiquitination pathway, thereby allowing activation of the NF-kappa-B complex. Activated NFKB complex translocates into the nucleus and binds DNA at kappa-B-binding motifs such as 5-prime GGGRNNYYCC 3-prime or 5-prime HGGARNYYCC 3-prime (where H is A, C, or T; R is an A or G purine; and Y is a C or T pyrimidine).[supplied by OMIM].

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
NF-kappa-B inhibitor beta isoform 1
NCBI Official Synonym Full Names
NFKB inhibitor beta
NCBI Official Symbol
NFKBIB
NCBI Official Synonym Symbols
IKBB; TRIP9
NCBI Protein Information
NF-kappa-B inhibitor beta
UniProt Protein Name
NF-kappa-B inhibitor beta
UniProt Gene Name
NFKBIB
UniProt Synonym Gene Names
IKBB; TRIP9; NF-kappa-BIB; IkB-B; IkB-beta; IkappaBbeta; TR-interacting protein 9; TRIP-9
UniProt Entry Name
IKBB_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The NFKBIB nfkbib (Catalog #AAA197822) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NFKBIB antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NFKBIB can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the NFKBIB nfkbib for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MLRPNPILAR LLRAHGAPEP EGEDEKSGPC SSSSDSDSGD EGDEYDDIVV. It is sometimes possible for the material contained within the vial of "NFKBIB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.