Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA28324_IF6.jpg IF (Immunofluorescence) (Immunofluorescence analysis of PC-12 cells using NLRP1 antibody at dilution of 1:200. Blue: DAPI for nuclear staining.)

Rabbit NLRP1 Polyclonal Antibody | anti-NLRP1 antibody

NLRP1 Rabbit pAb

Gene Names
NLRP1; NAC; CARD7; CIDED; NALP1; SLEV1; DEFCAP; PP1044; VAMAS1; CLR17.1; DEFCAP-L/S
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity purification
Synonyms
NLRP1, Antibody; NLRP1 Rabbit pAb; NLRP1; AIADK; CARD7; CIDED; CLR17.1; DEFCAP; DEFCAP-L/S; MSPC; NAC; NALP1; PP1044; SLEV1; VAMAS1; anti-NLRP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
TGEMSNSTSSLKRQRLGSERAASHVAQANLKLLDVSKIFPIAEIAGKSHEESSPEVVPVELLCVPSPASQGDLHTKPLGTDDDFWGPTGPVATEVVDKEKN
Applicable Applications for anti-NLRP1 antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:200
IF: 1:50-1:200
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1000-1100 of human NLRP1 (NP_001028225.1).
Positive Samples
HeLa, SH-SY5Y
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of PC-12 cells using NLRP1 antibody at dilution of 1:200. Blue: DAPI for nuclear staining.)

product-image-AAA28324_IF6.jpg IF (Immunofluorescence) (Immunofluorescence analysis of PC-12 cells using NLRP1 antibody at dilution of 1:200. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH/3T3 cells using NLRP1 antibody at dilution of 1:200. Blue: DAPI for nuclear staining.)

product-image-AAA28324_IF5.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH/3T3 cells using NLRP1 antibody at dilution of 1:200. Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat brain using NLRP1 Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA28324_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat brain using NLRP1 Rabbit pAb at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse brain using NLRP1 Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA28324_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse brain using NLRP1 Rabbit pAb at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human lung cancer using NLRP1 Rabbit pAb at dilution of 1:100 (40x lens).)

product-image-AAA28324_IHC2.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human lung cancer using NLRP1 Rabbit pAb at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using NLRP1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

product-image-AAA28324_WB.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using NLRP1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Related Product Information for anti-NLRP1 antibody
Background: This gene encodes a member of the Ced-4 family of apoptosis proteins. Ced-family members contain a caspase recruitment domain (CARD) and are known to be key mediators of programmed cell death. The encoded protein contains a distinct N-terminal pyrin-like motif, which is possibly involved in protein-protein interactions. This protein interacts strongly with caspase 2 and weakly with caspase 9. Overexpression of this gene was demonstrated to induce apoptosis in cells. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene, but the biological validity of some variants has not been determined.
Product Categories/Family for anti-NLRP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
46,068 Da
NCBI Official Full Name
NALP1
NCBI Official Synonym Full Names
NLR family, pyrin domain containing 1
NCBI Official Symbol
NLRP1
NCBI Official Synonym Symbols
NAC; CARD7; CIDED; NALP1; SLEV1; DEFCAP; PP1044; VAMAS1; CLR17.1; DEFCAP-L/S
NCBI Protein Information
NACHT, LRR and PYD domains-containing protein 1; caspase recruitment domain protein 7; NACHT, LRR and PYD containing protein 1; NACHT, leucine rich repeat and PYD containing 1; caspase recruitment domain-containing protein 7; nucleotide-binding domain and
UniProt Protein Name
NACHT, LRR and PYD domains-containing protein 1
UniProt Gene Name
NLRP1
UniProt Synonym Gene Names
CARD7; DEFCAP; KIAA0926; NAC; NALP1
UniProt Entry Name
NALP1_HUMAN

Similar Products

Product Notes

The NLRP1 nlrp1 (Catalog #AAA28324) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NLRP1 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NLRP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF). WB: 1:500-1:2000 IHC: 1:50-1:200 IF: 1:50-1:200. Researchers should empirically determine the suitability of the NLRP1 nlrp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TGEMSNSTSS LKRQRLGSER AASHVAQANL KLLDVSKIFP IAEIAGKSHE ESSPEVVPVE LLCVPSPASQ GDLHTKPLGT DDDFWGPTGP VATEVVDKEK N. It is sometimes possible for the material contained within the vial of "NLRP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.