Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283175_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of Jurkat cells using NLRP3 Rabbit pAb(AAA283175) at a dilution of 1:200 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

Rabbit anti-Mouse NLRP3 Polyclonal Antibody | anti-Nlrp3 antibody

NLRP3 Rabbit pAb

Average rating 0.0
No ratings yet
Reactivity
Mouse
Applications
ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
NLRP3, Antibody; NLRP3 Rabbit pAb; FCU; MWS; FCAS; Cias1; Mmig1; NALP3; Pypaf1; AII/AVP; AGTAVPRL; NLRP3; anti-Nlrp3 antibody
Ordering
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
MTSVRCKLAQYLEDLEDVDLKKFKMHLEDYPPEKGCIPVPRGQMEKADHLDLATLMIDFNGEEKAWAMAVWIFAAINRRDLWEKAKKDQPEWN
Applicable Applications for anti-Nlrp3 antibody
ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot)
Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-93 of mouse NLRP3 (NP_665826.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of Jurkat cells using NLRP3 Rabbit pAb(AAA283175) at a dilution of 1:200 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

product-image-AAA283175_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of Jurkat cells using NLRP3 Rabbit pAb(AAA283175) at a dilution of 1:200 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of PC-12 cells using NLRP3 Rabbit pAb(AAA283175) at a dilution of 1:200 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

product-image-AAA283175_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of PC-12 cells using NLRP3 Rabbit pAb(AAA283175) at a dilution of 1:200 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of THP-1 cells using NLRP3 Rabbit pAb(AAA283175) at a dilution of 1:200 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

product-image-AAA283175_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of THP-1 cells using NLRP3 Rabbit pAb(AAA283175) at a dilution of 1:200 (40x lens). Secondary antibody:Cy3 Goat Anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of lysates from RAW 264.7 cells using NLRP3 Rabbit pAb (AAA283175) at 1:5000 dilution. Raw 264.7 cells were treated by LPS (1 ug/ml) at 37? for 8 hours.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

product-image-AAA283175_WB15.jpg WB (Western Blot) (Western blot analysis of lysates from RAW 264.7 cells using NLRP3 Rabbit pAb (AAA283175) at 1:5000 dilution. Raw 264.7 cells were treated by LPS (1 ug/ml) at 37? for 8 hours.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)
Related Product Information for anti-Nlrp3 antibody
Enables DNA-binding transcription factor binding activity and sequence-specific DNA binding activity. Involved in several processes, including positive regulation of T-helper cell differentiation; positive regulation of cytokine production; and response to bacterium. Acts upstream of or within several processes, including NLRP3 inflammasome complex assembly; activation of cysteine-type endopeptidase activity involved in apoptotic process; and defense response to virus. Located in cytoplasm and nucleus. Part of NLRP3 inflammasome complex. Is expressed in central nervous system and retina. Used to study CINCA Syndrome; familial cold autoinflammatory syndrome 1; and non-alcoholic fatty liver disease. Human ortholog(s) of this gene implicated in CINCA Syndrome; Muckle-Wells syndrome; autosomal dominant nonsyndromic deafness 34; familial cold autoinflammatory syndrome 1; and urticaria. Orthologous to human NLRP3 (NLR family pyrin domain containing 3).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated MW: 118kDa
Observed MW: 110kDa
UniProt Protein Name
NACHT, LRR and PYD domains-containing protein 3
UniProt Gene Name
Nlrp3
UniProt Synonym Gene Names
Cias1; Mmig1; Nalp3; Pypaf1
UniProt Entry Name
NALP3_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Nlrp3 nlrp3 (Catalog #AAA283175) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NLRP3 Rabbit pAb reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's NLRP3 can be used in a range of immunoassay formats including, but not limited to, ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the Nlrp3 nlrp3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTSVRCKLAQ YLEDLEDVDL KKFKMHLEDY PPEKGCIPVP RGQMEKADHL DLATLMIDFN GEEKAWAMAV WIFAAINRRD LWEKAKKDQP EWN. It is sometimes possible for the material contained within the vial of "NLRP3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.