Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46563_AD10.jpg Application Data

NM23A Polyclonal Antibody | anti-NM23A antibody

Anti-NM23A Antibody

Gene Names
NME1; NB; AWD; NBS; GAAD; NDKA; NM23; NDPKA; NDPK-A; NM23-H1
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
NM23A, Antibody; Anti-NM23A Antibody; Nucleoside diphosphate kinase A; AWD; AWD, drosophila, homolog of; GAAD; Granzyme A activated DNase; Granzyme A-activated DNase; GZMA activated DNase; Metastasis inhibition factor NM23; NB; NBS; NDK A; NDKA; NDKA_HUMAN; NDP kinase A; NDPK-A; NDPKA; NM23; NM23 long variant, included; nm23-H1; NM23-M1; NM23H1B, included; NME/NM23 nucleoside diphosphate kinase 1; Nme1; NME1-NME2 spliced read-through transcript, included; Non-metastatic cells 1, protein (NM23A) expressed in; Nonmetastatic cells 1, protein expressed in; Nonmetastatic protein 23; Nonmetastatic protein 23, homolog 1; Tumor metastatic process-associated protein antibody; anti-NM23A antibody
Ordering
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
152
Applicable Applications for anti-NM23A antibody
WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human NM23A (26-58aa KRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDR), different from the related mouse and rat sequences by two amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Application Data

product-image-AAA46563_AD10.jpg Application Data

Application Data

product-image-AAA46563_AD11.jpg Application Data

Application Data

product-image-AAA46563_AD13.jpg Application Data

WB (Western Blot)

(Anti- NM23A antibody, Western blottingAll lanes: Anti NM23A at 0.5ug/ml)

product-image-AAA46563_WB15.jpg WB (Western Blot) (Anti- NM23A antibody, Western blottingAll lanes: Anti NM23A at 0.5ug/ml)
Related Product Information for anti-NM23A antibody
Description: Rabbit IgG polyclonal antibody for Nucleoside diphosphate kinase A(NME1) detection. Tested with WB in Human;Mouse;Rat.

Background: NME1(NME/NM23 nucleoside diphosphate kinase 1), also called non-metastatic cells 1, protein (NM23A) expressed in, NM23, NM23-H1, NDPKA, GAAD or AWD, is an enzyme that in humans is encoded by the NME1 gene. The promoters of the mouse and human NME1 genes, like those of other NME genes, contain several binding sites for AP2, NF1, Sp1, LEF1, and response elements to glucocorticoid receptors. The NME1 gene is mapped on 17q21.33. Immunofluorescence microscopy demonstrated colocalization of NME1 in nuclei of B cells expressing EBNA3C. Expression of EBNA3C reversed the ability of NME1 to inhibit migration of BL and breast carcinoma cells. NM23H1 bound SET and was released from inhibition by GZMA cleavage of SET. After GZMA loading or cytotoxic T lymphocyte attack, SET and NM23H1 translocated to the nucleus and SET was degraded, allowing NM23H1 to nick chromosomal DNA. Using a Drosophila model system, Dammai et al. (2003) showed that the Drosophila NME1 homolog, awd, regulates trachea cell motility by modulating FGFR levels through a dynamin -mediated pathway.
References
1. Chang, C. L., Zhu, X., Thoraval, D. H., Ungar, D., Rawwas, J., Hora, N., Strahler, J. R., Hanash, S. M., Radany, E. nm23-H1 mutation in neuroblastoma. (Letter) Nature 370: 335-336, 1994. 2. Dammai, V., Adryan, B., Lavenburg, K. R., Hsu, T. Drosophila awd, the homolog of human nm23, regulates FGF receptor levels and functions synergistically with shi/dynamin during tracheal development. Genes Dev. 17: 2812-2824, 2003. 3. Dooley, S., Seib, T., Engel, M., Theisinger, B., Janz, H., Piontek, K., Zang, K.-D., Welter, C. Isolation and characterization of the human genomic locus coding for the putative metastasis control gene nm23-H1. Hum. Genet. 93: 63-66, 1994.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30,137 Da
NCBI Official Full Name
nucleoside diphosphate kinase A isoform b
NCBI Official Synonym Full Names
NME/NM23 nucleoside diphosphate kinase 1
NCBI Official Symbol
NME1
NCBI Official Synonym Symbols
NB; AWD; NBS; GAAD; NDKA; NM23; NDPKA; NDPK-A; NM23-H1
NCBI Protein Information
nucleoside diphosphate kinase A
UniProt Protein Name
Nucleoside diphosphate kinase A
UniProt Gene Name
NME1
UniProt Synonym Gene Names
NDPKA; NM23; NDK A; NDP kinase A; GAAD
UniProt Entry Name
NDKA_HUMAN

Similar Products

Product Notes

The NM23A nme1 (Catalog #AAA46563) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-NM23A Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NM23A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the NM23A nme1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NM23A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.