nmt55/p54nrb Polyclonal Antibody | anti-NONO antibody

Anti-nmt55/p54nrb Antibody

Cat. Num. AAA46409

• Gene Names: NONO; P54; NMT55; NRB54; MRXS34; P54NRB; PPP1R114
• Reactivity: Human, Mouse, Rat
• Applications: Immunohistochemistry, Western Blot
• Purity: Immunogen Affinity Purified
• Synonyms: nmt55/p54nrb, Antibody; Anti-nmt55/p54nrb Antibody; Non-POU domain-containing octamer-binding protein; 52 kDa subunit; 54 kDa nuclear RNA and DNA binding protein; 54 kDa nuclear RNA- and DNA-binding protein; 55 kDa nuclear protein; DNA binding p52/p100 complex 52 kDa subunit; DNA-binding p52/p100 complex; NMT 55; NMT55; Non Pou domain containing octamer (ATGCAAAT) binding protein; Non POU domain containing octamer binding; Non POU domain containing octamer binding protein; Nono; NonO protein; NONO_HUMAN; NRB 54; NRB; NRB54; Nuclear RNA binding protein 54kD; P54; p54(nrb); p54nrb; PPP1R114; Protein phosphatase 1 regulatory subunit 114; non-POU domain containing, octamer-binding; anti-NONO antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 471

• Applicable Applications for anti-NONO antibody: IHC (Immunohistochemistry), WB (Western Blot)
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human nmt55/p54nrb (1-35aa MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQ), identical to the related mouse and rat sequences.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(nmt55/p54nrb was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- nmt55/p54nrb Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohistochemisry)

(nmt55/p54nrb was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- nmt55/p54nrb Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohiostchemistry)

(nmt55/p54nrb was detected in paraffin-embedded sections of mouse brain tissues using rabbit anti- nmt55/p54nrb Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

WB (Western Blot)

(Western blot analysis of nmt55/p54nrb expression in rat brain extract (lane 1), human placenta extract (lane 2) and PANC whole cell lysates (lane 3). nmt55/p54nrb at 60KD was detected using rabbit anti-FBXL4 Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.)

Related Product Information for anti-NONO antibody

Description: Rabbit IgG polyclonal antibody for Non-POU domain-containing octamer-binding protein(NONO) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Non-POU domain-containing octamer-binding protein is a protein that in humans is encoded by the NONO gene. This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16. 

References

1. "Entrez Gene: NONO Non-POU domain containing, octamer-binding". 2. Dong B, Horowitz DS, Kobayashi R, Krainer AR (Oct 1993). "Purification and cDNA cloning of HeLa cell p54nrb, a nuclear protein with two RNA recognition motifs and extensive homology to human splicing factor PSF and Drosophila NONA/BJ6". Nucleic Acids Res. 21 (17): 4085-92. 3. Traish AM, Huang YH, Ashba J, Pronovost M, Pavao M, McAneny DB, Moreland RB (Dec 1997). "Loss of expression of a 55 kDa nuclear protein (nmt55) in estrogen receptor-negative human breast cancer". Diagn. Mol. Pathol. 6(4): 209-21.

NCBI and Uniprot Product Information

• NCBI GI #: 224028244
• NCBI GeneID: 4841
• NCBI Accession #: NP_001138880.1
• NCBI GenBank Nucleotide #: NM_001145408.1
• UniProt Accession #: Q15233; O00201; P30807; Q12786; Q9BQC5; B7Z4C2; D3DVV4; F5GYZ3
• Molecular Weight: 43,866 Da
• NCBI Official Full Name: non-POU domain-containing octamer-binding protein isoform 1
• NCBI Official Synonym Full Names: non-POU domain containing, octamer-binding
• NCBI Official Symbol: NONO
• NCBI Official Synonym Symbols: P54; NMT55; NRB54; MRXS34; P54NRB; PPP1R114
• NCBI Protein Information: non-POU domain-containing octamer-binding protein
• UniProt Protein Name: Non-POU domain-containing octamer-binding protein
• UniProt Gene Name: NONO
• UniProt Synonym Gene Names: NRB54; NonO protein; p54nrb
• UniProt Entry Name: NONO_HUMAN