Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46409_IHC10.jpg IHC (Immunohistochemistry) (nmt55/p54nrb was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- nmt55/p54nrb Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

nmt55/p54nrb Polyclonal Antibody | anti-NONO antibody

Anti-nmt55/p54nrb Antibody

Average rating 0.0
No ratings yet
Gene Names
NONO; P54; NMT55; NRB54; MRXS34; P54NRB; PPP1R114
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
nmt55/p54nrb, Antibody; Anti-nmt55/p54nrb Antibody; Non-POU domain-containing octamer-binding protein; 52 kDa subunit; 54 kDa nuclear RNA and DNA binding protein; 54 kDa nuclear RNA- and DNA-binding protein; 55 kDa nuclear protein; DNA binding p52/p100 complex 52 kDa subunit; DNA-binding p52/p100 complex; NMT 55; NMT55; Non Pou domain containing octamer (ATGCAAAT) binding protein; Non POU domain containing octamer binding; Non POU domain containing octamer binding protein; Nono; NonO protein; NONO_HUMAN; NRB 54; NRB; NRB54; Nuclear RNA binding protein 54kD; P54; p54(nrb); p54nrb; PPP1R114; Protein phosphatase 1 regulatory subunit 114; non-POU domain containing, octamer-binding; anti-NONO antibody
Ordering
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
471
Applicable Applications for anti-NONO antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human nmt55/p54nrb (1-35aa MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQ), identical to the related mouse and rat sequences.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(nmt55/p54nrb was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- nmt55/p54nrb Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46409_IHC10.jpg IHC (Immunohistochemistry) (nmt55/p54nrb was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- nmt55/p54nrb Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohistochemisry)

(nmt55/p54nrb was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- nmt55/p54nrb Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46409_IHC11.jpg IHC (Immunohistochemisry) (nmt55/p54nrb was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- nmt55/p54nrb Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohiostchemistry)

(nmt55/p54nrb was detected in paraffin-embedded sections of mouse brain tissues using rabbit anti- nmt55/p54nrb Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46409_IHC13.jpg IHC (Immunohiostchemistry) (nmt55/p54nrb was detected in paraffin-embedded sections of mouse brain tissues using rabbit anti- nmt55/p54nrb Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

WB (Western Blot)

(Western blot analysis of nmt55/p54nrb expression in rat brain extract (lane 1), human placenta extract (lane 2) and PANC whole cell lysates (lane 3). nmt55/p54nrb at 60KD was detected using rabbit anti-FBXL4 Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.)

product-image-AAA46409_WB15.jpg WB (Western Blot) (Western blot analysis of nmt55/p54nrb expression in rat brain extract (lane 1), human placenta extract (lane 2) and PANC whole cell lysates (lane 3). nmt55/p54nrb at 60KD was detected using rabbit anti-FBXL4 Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.)
Related Product Information for anti-NONO antibody
Description: Rabbit IgG polyclonal antibody for Non-POU domain-containing octamer-binding protein(NONO) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Non-POU domain-containing octamer-binding protein is a protein that in humans is encoded by the NONO gene. This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16. 
References
1. "Entrez Gene: NONO Non-POU domain containing, octamer-binding". 2. Dong B, Horowitz DS, Kobayashi R, Krainer AR (Oct 1993). "Purification and cDNA cloning of HeLa cell p54nrb, a nuclear protein with two RNA recognition motifs and extensive homology to human splicing factor PSF and Drosophila NONA/BJ6". Nucleic Acids Res. 21 (17): 4085-92. 3. Traish AM, Huang YH, Ashba J, Pronovost M, Pavao M, McAneny DB, Moreland RB (Dec 1997). "Loss of expression of a 55 kDa nuclear protein (nmt55) in estrogen receptor-negative human breast cancer". Diagn. Mol. Pathol. 6(4): 209-21.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,866 Da
NCBI Official Full Name
non-POU domain-containing octamer-binding protein isoform 1
NCBI Official Synonym Full Names
non-POU domain containing, octamer-binding
NCBI Official Symbol
NONO
NCBI Official Synonym Symbols
P54; NMT55; NRB54; MRXS34; P54NRB; PPP1R114
NCBI Protein Information
non-POU domain-containing octamer-binding protein
UniProt Protein Name
Non-POU domain-containing octamer-binding protein
UniProt Gene Name
NONO
UniProt Synonym Gene Names
NRB54; NonO protein; p54nrb
UniProt Entry Name
NONO_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The NONO nono (Catalog #AAA46409) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-nmt55/p54nrb Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's nmt55/p54nrb can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the NONO nono for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "nmt55/p54nrb, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.