Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA125160_IHC11.jpg IHC (Immunohistochemisry) (Figure 3. IHC analysis of nmt55 p54nrb using anti-nmt55 p54nrb antibody (M03515).nmt55 p54nrb was detected in immunocytochemical section of A431 cell. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml mouse anti-nmt55 p54nrb Antibody (M03515) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

Mouse anti-Human nmt55 p54nrb Monoclonal Antibody | anti-NONO antibody

Anti-nmt55 p54nrb Antibody (monoclonal, 11E2)

Average rating 0.0
No ratings yet
Gene Names
NONO; P54; NMT55; NRB54; MRXS34; P54NRB; PPP1R114
Reactivity
Human
Applications
Flow Cytometry, Functional Assay, Immunocytochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
nmt55 p54nrb, Antibody; Anti-nmt55 p54nrb Antibody (monoclonal, 11E2); Non-POU domain-containing octamer-binding protein; NonO protein; 54 kDa nuclear RNA- and DNA-binding protein; 55 kDa nuclear protein; DNA-binding p52/p100 complex, 52 kDa subunit; NMT55; p54 (nrb); p54nrb; NONO; NRB54; Non-POU domain containing, octamer-binding; anti-NONO antibody
Ordering
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1
Clone Number
11E2
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized
Sequence Length
382
Applicable Applications for anti-NONO antibody
FCM/FACS (Flow Cytometry), ICC (Immunocytochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human nmt55 p54nrb (1-35aa MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQ), identical to the related mouse and rat sequences.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Relevant Detection Systems
It is recommended to use an Enhanced Chemiluminescent Kit with anti-Rabbit IgG (MBS176460) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (MBS176453) for ICC
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time.
Avoid repeated freezing and thawing.

IHC (Immunohistochemisry)

(Figure 3. IHC analysis of nmt55 p54nrb using anti-nmt55 p54nrb antibody (M03515).nmt55 p54nrb was detected in immunocytochemical section of A431 cell. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml mouse anti-nmt55 p54nrb Antibody (M03515) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA125160_IHC11.jpg IHC (Immunohistochemisry) (Figure 3. IHC analysis of nmt55 p54nrb using anti-nmt55 p54nrb antibody (M03515).nmt55 p54nrb was detected in immunocytochemical section of A431 cell. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml mouse anti-nmt55 p54nrb Antibody (M03515) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

IHC (Immunohiostchemistry)

(Figure 3. IHC analysis of nmt55 p54nrb using anti-nmt55 p54nrb antibody (M03515).nmt55 p54nrb was detected in immunocytochemical section of A431 cell. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml mouse anti-nmt55 p54nrb Antibody (M03515) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA125160_IHC13.jpg IHC (Immunohiostchemistry) (Figure 3. IHC analysis of nmt55 p54nrb using anti-nmt55 p54nrb antibody (M03515).nmt55 p54nrb was detected in immunocytochemical section of A431 cell. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml mouse anti-nmt55 p54nrb Antibody (M03515) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

WB (Western Blot)

(Figure 1. Western blot analysis of nmt55 p54nrb using anti-nmt55 p54nrb antibody (M03515).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: human HELA whole cell lysate,Lane 2: human Placent tissue lysate,Lane 3: human MCF-7 whole cell lysate,Lane 4: human A549 whole cell lysate,Lane 5: human SW620 whole cell lysate,Lane 6: human PANC-1 whole cell lysate,Lane 7: human U20S whole cell lysate,Lane 8: human K562 whole cell lysate.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-nmt55 p54nrb antigen affinity purified monoclonal antibody at 0.5 ug/ml overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system.)

product-image-AAA125160_WB15.jpg WB (Western Blot) (Figure 1. Western blot analysis of nmt55 p54nrb using anti-nmt55 p54nrb antibody (M03515).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: human HELA whole cell lysate,Lane 2: human Placent tissue lysate,Lane 3: human MCF-7 whole cell lysate,Lane 4: human A549 whole cell lysate,Lane 5: human SW620 whole cell lysate,Lane 6: human PANC-1 whole cell lysate,Lane 7: human U20S whole cell lysate,Lane 8: human K562 whole cell lysate.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-nmt55 p54nrb antigen affinity purified monoclonal antibody at 0.5 ug/ml overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system.)
Related Product Information for anti-NONO antibody
Description: Mouse IgG monoclonal antibody for nmt55 p54nrb detection. Tested with WB, ICC, FCM in Human.
Background: Non-POU domain-containing octamer-binding protein is a protein that in humans is encoded by the NONO gene. This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16.
References
1. "Entrez Gene: NONO Non-POU domain containing, octamer-binding". 2. Dong B, Horowitz DS, Kobayashi R, Krainer AR (Oct 1993). "Purification and cDNA cloning of HeLa cell p54nrb, a nuclear protein with two RNA recognition motifs and extensive homology to human splicing factor PSF and Drosophila NONA/BJ6". Nucleic Acids Res. 21 (17): 4085-92. 3. Traish AM, Huang YH, Ashba J, Pronovost M, Pavao M, McAneny DB, Moreland RB (Dec 1997). "Loss of expression of a 55 kDa nuclear protein (nmt55) in estrogen receptor-negative human breast cancer". Diagn. Mol. Pathol. 6 (4): 209-21.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,866 Da
NCBI Official Full Name
non-POU domain-containing octamer-binding protein isoform 1
NCBI Official Synonym Full Names
non-POU domain containing octamer binding
NCBI Official Symbol
NONO
NCBI Official Synonym Symbols
P54; NMT55; NRB54; MRXS34; P54NRB; PPP1R114
NCBI Protein Information
non-POU domain-containing octamer-binding protein
UniProt Protein Name
Non-POU domain-containing octamer-binding protein
UniProt Gene Name
NONO
UniProt Synonym Gene Names
NRB54; NonO protein; p54nrb

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The NONO nono (Catalog #AAA125160) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Anti-nmt55 p54nrb Antibody (monoclonal, 11E2) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's nmt55 p54nrb can be used in a range of immunoassay formats including, but not limited to, FCM/FACS (Flow Cytometry), ICC (Immunocytochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the NONO nono for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "nmt55 p54nrb, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.