Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198468_WB8.jpg WB (Western Blot) (WB Suggested Anti-NOTCH1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)

Rabbit NOTCH1 Polyclonal Antibody | anti-NOTCH1 antibody

NOTCH1 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
NOTCH1; hN1; AOS5; TAN1; AOVD1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NOTCH1, Antibody; NOTCH1 antibody - middle region; anti-NOTCH1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Specificity
Antibody recognizes 88 kDa for Notch1 intracellular domain.
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EHPFLTPSPESPDQWSSSSPHSNVSDWSEGVSSPPTSMQSQIARIPEAFK
Sequence Length
2555
Applicable Applications for anti-NOTCH1 antibody
WB (Western Blot)
Homology
Cow: 79%; Dog: 79%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 79%; Rat: 93%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NOTCH1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-NOTCH1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)

product-image-AAA198468_WB8.jpg WB (Western Blot) (WB Suggested Anti-NOTCH1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: NOTCH1Sample Tissue: Human U937 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA198468_WB10.jpg WB (Western Blot) (Host: RabbitTarget Name: NOTCH1Sample Tissue: Human U937 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: NOTCH1Sample Tissue: Human PANC1 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA198468_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: NOTCH1Sample Tissue: Human PANC1 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: NOTCH1Sample Tissue: Human HT1080 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA198468_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: NOTCH1Sample Tissue: Human HT1080 Whole CellAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-NOTCH1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Plasma membranePrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA198468_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-NOTCH1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Plasma membranePrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-NOTCH1 antibody
This is a rabbit polyclonal antibody against NOTCH1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: NOTCH1 is a member of the Notch family. Notch family members play a role in a variety of developmental processes by controlling cell fate decisions. The Notch signaling network is an evolutionarily conserved intercellular signaling pathway which regulates interactions between physically adjacent cells. This protein is cleaved in the trans-Golgi network, and presented on the cell surface as a heterodimer. This protein functions as a receptor for membrane bound ligands, and may play multiple roles during development.This gene encodes a member of the Notch family. Members of this Type 1 transmembrane protein family share structural characteristics including an extracellular domain consisting of multiple epidermal growth factor-like (EGF) repeats, and an intracellular domain consisting of multiple, different domain types. Notch family members play a role in a variety of developmental processes by controlling cell fate decisions. The Notch signaling network is an evolutionarily conserved intercellular signaling pathway which regulates interactions between physically adjacent cells. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signaling pathway that plays a key role in development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remain to be determined. This protein is cleaved in the trans-Golgi network, and presented on the cell surface as a heterodimer. This protein functions as a receptor for membrane bound ligands, and may play multiple roles during development. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
88kDa
NCBI Official Full Name
neurogenic locus notch homolog protein 1 preproprotein
NCBI Official Synonym Full Names
notch receptor 1
NCBI Official Symbol
NOTCH1
NCBI Official Synonym Symbols
hN1; AOS5; TAN1; AOVD1
NCBI Protein Information
neurogenic locus notch homolog protein 1
UniProt Protein Name
Neurogenic locus notch homolog protein 1
UniProt Gene Name
NOTCH1
UniProt Synonym Gene Names
TAN1; Notch 1; hN1; NICD
UniProt Entry Name
NOTC1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The NOTCH1 notch1 (Catalog #AAA198468) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NOTCH1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's NOTCH1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the NOTCH1 notch1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EHPFLTPSPE SPDQWSSSSP HSNVSDWSEG VSSPPTSMQS QIARIPEAFK. It is sometimes possible for the material contained within the vial of "NOTCH1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.